KEGG   Deinococcus proteolyticus: Deipr_1618Help
Entry
Deipr_1618        CDS       T01426                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritolkinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
dpt  Deinococcus proteolyticus
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:dpt00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1726150..1727064)
Genome map
AA seq 304 aa AA seqDB search
MNRSKSLRVAGSKANQPSTYFAPAKTNLGLSILGVRPDGYHDLSSLMVPLSVGDELSFAP
APTLTLSIDGPYGTGLPTDERNLVYRAARSYLDAAGVTEGVHITLTKRLPLASGLGGGSS
DAATTLLALADLYPAQLDLPALALQLGADVPFFLLGSAALAEGVGERLGPVPDLPPVHLV
LANPGSEVSAGDAYRWLDETGEFGPTLNLPGIITALQQGRELPYFNSLQSGVLRRHPEIE
ATLQALADAGLHSVLMSGSGATCFGLARDAAHAEAVAAELQAAQPGWWVTSAQVLTGTSR
VDHG
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
gtgaataggtctaagagtttaagagtcgcagggtctaaggctaaccaaccctcaacctac
ttcgctcccgccaagaccaacctcggcctcagcatcctcggcgtgcggcccgacggctac
cacgacctctccagcctgatggtgccgctcagcgtgggcgacgaactgagctttgcgcct
gcgccgaccctgacgctgagcattgacgggccatacggcacaggcctgcccaccgacgag
cgcaatctggtctaccgtgccgcgcggagctatctggacgcggcgggcgtgaccgagggc
gtccacatcaccctgaccaagcgtttgccactggcttcgggcctcggcgggggcagcagc
gacgcggcgaccacgctgctggcgctggccgacctgtatcccgctcagctggatttgcct
gcgctggcgctgcaactcggcgcggacgtgccctttttcctgctcggcagcgcagccctt
gcagaaggcgtgggcgaacgcctcggccccgtccccgacttgccccccgtccatctggtg
ttggcgaaccccggcagtgaagtcagcgcgggcgacgcctaccgctggctggacgaaacg
ggcgaattcggccccacgctgaacctgccgggcatcattactgcgctgcagcaggggcgc
gaactgccttatttcaactcgctgcagagcggtgtgctgcgccgccacccggaaatcgag
gccaccttgcaggcgctggcggacgcaggcctgcactcggtgctgatgagcggctcaggc
gcgacttgcttcgggctggcgcgggacgctgctcacgctgaggctgtcgctgccgagctt
caggccgcgcagccgggctggtgggtcacgtcggcgcaggtgctcaccggtacaagccgc
gtagatcacggctaa

DBGET integrated database retrieval system