KEGG   Deinococcus proteolyticus: Deipr_1754Help
Entry
Deipr_1754        CDS       T01426                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
dpt  Deinococcus proteolyticus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dpt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Deipr_1754
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Deipr_1754
  Amino acid metabolism
   00310 Lysine degradation
    Deipr_1754
Enzymes [BR:dpt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Deipr_1754
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1864829..1866070)
Genome map
AA seq 413 aa AA seqDB search
MSQIKVPVFSESVSEGTLLAWNVQPGSAVKRGDVLAEIETDKVVLEVIAQEDGVLKSVTK
NEGDTVLSEEVLGELGAGEAGAAPAAEAPATSADPSQSAGGESQAREPQAVPAPAAQSER
RDDLSPAVRKIVAEKGLDASQVPATGPRGNITKADAMNAQPGQAAPAQAGAQPAAQIPAG
ARPEERVPMTRIRQKIAERLKEVQDTTAMLTTFNEVDMKPIMDLRKKYQDQFVAKHDIKL
GFMSFFVRAATEALKQFPVVNASVDGKDIIYHGFYDIGIAVSTDRGLVVPILRDTDQLGL
ADIEKGIGDFAKKARAGKLTMEDMSGGTFTITNGGTFGSMMSTPIINAPQSAILGMHNIV
ERPVVVNGEIVIRPMMYVALSYDHRIIDGRDSVQFLVTIKNLLEDPARLLLDL
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagatcaaagttcccgtattcagcgaatccgtttccgaaggcaccctgctggcc
tggaacgtgcagcccggtagcgcggtcaagcgcggcgacgtgctggccgaaatcgagacc
gacaaggtcgtgctggaagtgattgcccaggaagacggcgtgctgaaaagcgtgaccaag
aacgaaggcgacaccgtgctcagcgaagaagtgctgggcgagctgggtgctggcgaggcg
ggcgctgctcctgcggcagaagctcccgcgaccagcgccgacccctcgcagagtgcgggc
ggtgaaagccaggcccgtgagcctcaggccgtgcctgcgcctgccgcccagagcgagcgc
cgtgacgacctgtcgcccgctgtccgcaagatcgtggctgaaaagggcctggacgcgtcc
caggtgccggccactggcccccgcggcaacatcaccaaggccgacgccatgaatgctcag
cccggtcaggctgcgccggcacaggcaggcgcccagccggcagcccagattcctgccggt
gcccgccccgaagagcgcgtgccgatgacccgcatccgccagaagattgccgagcgcctc
aaggaagtgcaggacaccaccgccatgctgaccaccttcaacgaggtggacatgaaaccc
atcatggacctgcgcaagaagtaccaagaccagttcgtggccaagcatgacatcaagctg
ggcttcatgagcttcttcgtgcgtgcggccactgaagccctcaagcagttccctgtggtg
aacgccagcgtagacggcaaggacatcatctaccacggcttctacgacatcggtattgcc
gtgtctaccgaccgtggcctggtggtgcctatcctgcgcgacaccgaccagctgggcctg
gccgacatcgaaaaaggcatcggcgactttgccaagaaggcccgcgccggcaagctgacc
atggaagacatgagcggcggcacctttaccatcaccaacggcggcaccttcggctcgatg
atgagcacccccatcatcaacgcgccccagagcgccatcctgggcatgcacaacatcgta
gagcgcccggtggtggtgaacggcgaaatcgtgattcgcccgatgatgtatgtggcgctg
agctacgaccaccgcatcattgacggccgcgacagcgtgcagttcctggtgaccatcaag
aacctgctggaagacccggcccgcctgctgctggacctctga

DBGET integrated database retrieval system