KEGG   Deinococcus proteolyticus: Deipr_1760Help
Entry
Deipr_1760        CDS       T01426                                 

Definition
Dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
dpt  Deinococcus proteolyticus
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dpt00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:dpt00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1871837..1872352
Genome map
AA seq 171 aa AA seqDB search
MSNKTPELVAIVAMTENRVIGRDGGMPWHLPADFAHFKRLSLGRPNVMGRRVWDSLGGKA
LPGRTNIVLTRQQSFGAPGALVAHSPAEALALAHAHLGPENEIAIIGGEEVYRLYLDDLT
RVELTLIHTRLEGDTFFPELPGEWDTVAERERPADERNRYDLTFRTLVRRG
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaataagactcccgaactggtcgccatcgtcgccatgaccgagaaccgcgtcatc
ggtagggacggcgggatgccctggcacctgcccgccgacttcgcgcacttcaagcggctc
agcctgggtaggcccaatgtgatgggccgccgcgtctgggactcgctgggcggcaaggcc
ctgcctggacgcaccaacatcgtgctgacccgccagcagagcttcggggccccgggggcg
ttggtcgcccactcgccggccgaggcgctggccctggcccacgcgcatctgggcccagag
aacgaaatcgccatcatcggcggcgaggaagtttaccggctgtacctggacgacctgacc
cgcgtagaactgaccctgattcacacccggctggaaggcgatacctttttcccggagctg
cccggcgagtgggacaccgtggccgagcgggagcgccccgccgacgagcgcaaccgctac
gacctgaccttccgcacgctggttcggcgcgggtag

DBGET integrated database retrieval system