KEGG   Deinococcus proteolyticus: Deipr_1883Help
Entry
Deipr_1883        CDS       T01426                                 

Definition
(GenBank) Cellulase (EC:3.2.1.4)
Organism
dpt  Deinococcus proteolyticus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1998180..1999250
Genome map
AA seq 356 aa AA seqDB search
MSLKETVIKHQEFLFDLLRAAGPSGYERRAADVWKKEAASFARVSEDHYGNVYAEIGPEG
APAVVLMGHLDEIGLIVSHISDQGFIYFLPVGGWDPQVLVGQRIRLLAPGGDIVGVIGKK
AIHVMSPEEREKASKLEDLWIDIGLDAEDTRAAVPVGTYGVIEQGPMMVGERIVARALDN
RAGSFAVLEALRQVHESGSELKHRVIAVGNSQEEIGTFGAVISAFKTRPVAGVAVDVTHE
TTQVGVEPKKYGQSPFGSGASLTVGPMSSPVVNRQLMDAAGKKGIPYTLSATGRYTFTDG
DALTLSREGVPSAVLSIPNRYMHSPSEMIDARDLQAVIDLLAAWVEGLEEGTSYQR
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgtcccttaaagaaacagtcattaaacaccaggagtttctcttcgacctgctgcgtgcc
gccggccccagcggctacgagcgccgcgccgccgacgtctggaaaaaggaagcagccagc
ttcgcccgcgtgagcgaggaccattacggcaacgtgtacgccgaaatcggccccgaggga
gcgcccgccgtggtgctgatgggccacctggacgaaatcggcctcatcgtgtcgcatatc
agcgaccagggctttatctactttctgccggtgggcggctgggacccgcaggtgctggtg
gggcagcgcatccgcctgctggctcccggcggcgacatcgtaggcgtgatcggcaaaaag
gccattcacgtgatgtcgcccgaggagcgcgaaaaggccagcaaactcgaagacctgtgg
attgacatcggcctggacgccgaggacacccgcgccgccgtgccggtgggcacctacggc
gtgattgagcaggggccgatgatggtgggtgagcgcatcgtggcgcgggccctggacaac
cgcgccggctcgttcgcggtccttgaagcgctgcgccaggtccatgaaagcggcagcgaa
ctgaagcaccgcgtgattgccgtgggcaacagccaggaagaaatcggcaccttcggggct
gtcatcagcgcgttcaagacccgtccagtggccggcgtagcagtggacgtgacccacgaa
accacccaggtcggtgtggaacccaagaagtacggccaaagccccttcggctccggcgcc
agcctgacggtaggccccatgagcagcccggtggtgaaccgccagctgatggacgccgca
ggcaaaaaaggtattccctacaccctgagcgccacaggccgctacaccttcaccgacggc
gacgccctgaccctcagccgagaaggtgtgcccagcgccgtgctgagtattccgaaccgc
tacatgcactcgcccagcgaaatgatcgacgcccgcgacctgcaggcggtgattgacctg
ctggccgcctgggtcgaaggtctggaagaaggcaccagctaccagcgctga

DBGET integrated database retrieval system