KEGG   Deinococcus proteolyticus: Deipr_1883Help
Entry
Deipr_1883        CDS       T01426                                 

Definition
Cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
dpt  Deinococcus proteolyticus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Deipr_1883
Enzymes [BR:dpt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Deipr_1883
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1998180..1999250
Genome map
AA seq 356 aa AA seqDB search
MSLKETVIKHQEFLFDLLRAAGPSGYERRAADVWKKEAASFARVSEDHYGNVYAEIGPEG
APAVVLMGHLDEIGLIVSHISDQGFIYFLPVGGWDPQVLVGQRIRLLAPGGDIVGVIGKK
AIHVMSPEEREKASKLEDLWIDIGLDAEDTRAAVPVGTYGVIEQGPMMVGERIVARALDN
RAGSFAVLEALRQVHESGSELKHRVIAVGNSQEEIGTFGAVISAFKTRPVAGVAVDVTHE
TTQVGVEPKKYGQSPFGSGASLTVGPMSSPVVNRQLMDAAGKKGIPYTLSATGRYTFTDG
DALTLSREGVPSAVLSIPNRYMHSPSEMIDARDLQAVIDLLAAWVEGLEEGTSYQR
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgtcccttaaagaaacagtcattaaacaccaggagtttctcttcgacctgctgcgtgcc
gccggccccagcggctacgagcgccgcgccgccgacgtctggaaaaaggaagcagccagc
ttcgcccgcgtgagcgaggaccattacggcaacgtgtacgccgaaatcggccccgaggga
gcgcccgccgtggtgctgatgggccacctggacgaaatcggcctcatcgtgtcgcatatc
agcgaccagggctttatctactttctgccggtgggcggctgggacccgcaggtgctggtg
gggcagcgcatccgcctgctggctcccggcggcgacatcgtaggcgtgatcggcaaaaag
gccattcacgtgatgtcgcccgaggagcgcgaaaaggccagcaaactcgaagacctgtgg
attgacatcggcctggacgccgaggacacccgcgccgccgtgccggtgggcacctacggc
gtgattgagcaggggccgatgatggtgggtgagcgcatcgtggcgcgggccctggacaac
cgcgccggctcgttcgcggtccttgaagcgctgcgccaggtccatgaaagcggcagcgaa
ctgaagcaccgcgtgattgccgtgggcaacagccaggaagaaatcggcaccttcggggct
gtcatcagcgcgttcaagacccgtccagtggccggcgtagcagtggacgtgacccacgaa
accacccaggtcggtgtggaacccaagaagtacggccaaagccccttcggctccggcgcc
agcctgacggtaggccccatgagcagcccggtggtgaaccgccagctgatggacgccgca
ggcaaaaaaggtattccctacaccctgagcgccacaggccgctacaccttcaccgacggc
gacgccctgaccctcagccgagaaggtgtgcccagcgccgtgctgagtattccgaaccgc
tacatgcactcgcccagcgaaatgatcgacgcccgcgacctgcaggcggtgattgacctg
ctggccgcctgggtcgaaggtctggaagaaggcaccagctaccagcgctga

DBGET integrated database retrieval system