KEGG   Deinococcus proteolyticus: Deipr_1896Help
Entry
Deipr_1896        CDS       T01426                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
dpt  Deinococcus proteolyticus
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:dpt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Deipr_1896
Enzymes [BR:dpt01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Deipr_1896
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2008736..2009659)
Genome map
AA seq 307 aa AA seqDB search
MLSGMTVAWPRRLHRLRFRRPLPASPGVLQDADGWWLHWRGCAVMGILNVTPDSFSDGGR
YAGLTAAVAQAESLHRAGALIIDVGGESTRPGSMGVDAAEEIDRVRPVVAALAERGFLVS
VDTLKAEVAAAALQAGAHLVNDVSGLRDQQMVQVCAEAGAPACLMHMQGAPRTMQDSPQY
EDVVAEVHSYLRCEAERVQAAGVPDVLLDPGLGFGKTLEHNLSLLRAVPDLAASPWPVLI
GASRKGMIGALSGEQDPAQRDPGSLALHLHAARAGAAMVRVHAVAQHVQALKVQAGLDVL
PGAGGER
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgctatcgggcatgactgtggcctggccgagacgcctgcaccgcctgcggttccgccgc
cctttgcccgcttcgccgggtgtcttgcaggatgcggacggatggtggctgcactggcgt
ggctgcgctgtgatgggcattttgaatgtgacccccgattcctttagcgatggcgggcgg
tatgccgggctgactgctgccgtcgcccaggcagagagcctgcaccgtgccggggccctt
atcatcgatgtgggtggggagagcacccgccctggttctatgggggtagatgccgccgag
gaaattgaccgggtgcggccggtggtagcggcgctggcggagcggggctttctggtcagt
gtggataccctcaaggccgaggtggcagctgcggccctgcaagctggcgcacacctggtc
aacgacgtgtcgggactgcgtgaccagcagatggtgcaggtttgtgcggaagccggggcg
cctgcttgcctgatgcacatgcagggtgccccccgcacgatgcaggacagcccccagtac
gaggatgtggtggccgaggttcacagctatctgcgctgcgaggcggagcgggttcaggct
gctggtgtgccggacgtgctgctggacccgggcctgggcttcggcaagacgctggagcac
aacctcagcctgctgcgggcagtgccggacctggcagcttcgccctggccggtgctgatt
ggggccagccgcaagggcatgattggtgccctgtcgggggaacaggacccggcgcagcgc
gaccctggttcactggcgctgcacctgcatgcagcacgggccggagcagcgatggtgcga
gtgcatgcggtggcccaacatgtccaggcgctgaaagtgcaggcgggtttagatgtcttg
cctggagctggaggtgagagatga

DBGET integrated database retrieval system