KEGG   Deinococcus proteolyticus: Deipr_2083Help
Entry
Deipr_2083        CDS       T01426                                 

Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
dpt  Deinococcus proteolyticus
Pathway
dpt00340  Histidine metabolism
dpt01100  Metabolic pathways
dpt01110  Biosynthesis of secondary metabolites
dpt01230  Biosynthesis of amino acids
Module
dpt_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:dpt00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Deipr_2083
Enzymes [BR:dpt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Deipr_2083
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh DUF1690
Motif
Other DBs
NCBI-ProteinID: ADY27214
UniProt: F0RQ12
Position
pDEIPR01:complement(66831..68153)
Genome map
AA seq 440 aa AA seqDB search
MTDRIPPISVWAELDTQARRELLRRPAQSADAEITARVRDILRQVREEGDRALLRLTAQY
DRVQLDSPLLSREQVETQAAQVDRTVRRAIDSAQRNIHAFHAAQQPQPVSVDTAPGVRCE
LRWAPIRTVGLYVPGGSAVLPSTVLMLGVPAALAGCERTVLCSPPDAQGMLSPAVCYAAL
KVGVTDVVRLGGAQAVAALAYGTASVPRADKIFGPGNAYVTAAKTLASAEAGGPAIDMPA
GPSELLVVADASAQAAWAAADLLSQAEHGPDSQVVLVSPERRVLEAVRRELARQLATLPR
QDTAARALARSRLILTASLDEAVQVADEYAPEHLSLQVTDPQALSGRIRAGSVFAGHLTP
EAGGDYATGTNHVLPTYGAARAFSSLGLADFYRRYTVQTVTAAGLEALAPTVTALAREEG
LEAHARAAEVRLNHIPGENA
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaccgcattccccctatcagcgtctgggccgagctggacacccaggcccgccgc
gagctgctgcgccgccccgcccagagcgccgacgccgaaatcaccgcccgggtgcgggat
attctgcggcaggtccgcgaggaaggtgaccgcgccctgctgcggctgactgcgcagtac
gaccgcgttcagctggactcgcccctgctgagccgcgagcaggtggaaacccaggccgcg
caggtggaccgcaccgttcgccgcgccattgacagcgcccagcgcaacatccatgccttt
cacgccgcgcagcagccgcagcctgtcagcgtggacaccgcgccgggcgtccgctgtgaa
ctgcgctgggcacctattcgcacggtgggcctgtatgtgccgggcgggagtgccgtgctg
ccctcgactgtgctgatgctgggggtgccggcggcgctggcaggctgcgaacggacagtg
ctgtgcagcccaccggacgcccagggcatgctctctccggccgtctgttacgccgctctg
aaagtgggcgtgaccgatgtcgtgcgcctgggcggagcgcaggcggtcgccgcgctggcc
tacggcacggccagcgtgccccgcgctgacaagattttcgggcctggcaacgcctacgtg
acggcggccaaaaccctggcaagcgctgaagcgggcggccccgccatagacatgcccgcc
ggcccctccgagctgctggtggtggccgatgccagcgcccaggccgcctgggctgccgcc
gacctgctgtcccaggccgagcacggccccgattcgcaggtggtgctggtcagccccgag
cgccgcgtgctggaagcggtgcgccgtgaactggcccggcaactggccaccctcccccgg
caggacaccgcggcccgcgccctggcccggagccgcctgattctgaccgccagcctggac
gaagccgtgcaggtggcggacgagtacgcccccgagcacctcagcctgcaggtgaccgac
ccgcaggccctgagcggccgcatccgcgccggctcggtgttcgccgggcacctgacccca
gaagcgggcggggactacgccaccggcaccaaccatgtgctgcccacctacggcgcggcg
cgggccttttccagcctgggcctggccgacttctaccgccgctacaccgtgcagaccgtg
acggccgccggcctggaggcgctggcccccaccgtgaccgccctggcgcgcgaagaaggc
ctggaagcccacgcccgcgccgccgaagtgcgcctgaaccacatcccaggagaaaatgca
tga

DBGET integrated database retrieval system