KEGG   Deinococcus proteolyticus: Deipr_2083Help
Entry
Deipr_2083        CDS       T01426                                 

Definition
Histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
dpt  Deinococcus proteolyticus
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:dpt01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:dpt00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pDEIPR01:complement(66831..68153)
Genome map
AA seq 440 aa AA seqDB search
MTDRIPPISVWAELDTQARRELLRRPAQSADAEITARVRDILRQVREEGDRALLRLTAQY
DRVQLDSPLLSREQVETQAAQVDRTVRRAIDSAQRNIHAFHAAQQPQPVSVDTAPGVRCE
LRWAPIRTVGLYVPGGSAVLPSTVLMLGVPAALAGCERTVLCSPPDAQGMLSPAVCYAAL
KVGVTDVVRLGGAQAVAALAYGTASVPRADKIFGPGNAYVTAAKTLASAEAGGPAIDMPA
GPSELLVVADASAQAAWAAADLLSQAEHGPDSQVVLVSPERRVLEAVRRELARQLATLPR
QDTAARALARSRLILTASLDEAVQVADEYAPEHLSLQVTDPQALSGRIRAGSVFAGHLTP
EAGGDYATGTNHVLPTYGAARAFSSLGLADFYRRYTVQTVTAAGLEALAPTVTALAREEG
LEAHARAAEVRLNHIPGENA
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaccgcattccccctatcagcgtctgggccgagctggacacccaggcccgccgc
gagctgctgcgccgccccgcccagagcgccgacgccgaaatcaccgcccgggtgcgggat
attctgcggcaggtccgcgaggaaggtgaccgcgccctgctgcggctgactgcgcagtac
gaccgcgttcagctggactcgcccctgctgagccgcgagcaggtggaaacccaggccgcg
caggtggaccgcaccgttcgccgcgccattgacagcgcccagcgcaacatccatgccttt
cacgccgcgcagcagccgcagcctgtcagcgtggacaccgcgccgggcgtccgctgtgaa
ctgcgctgggcacctattcgcacggtgggcctgtatgtgccgggcgggagtgccgtgctg
ccctcgactgtgctgatgctgggggtgccggcggcgctggcaggctgcgaacggacagtg
ctgtgcagcccaccggacgcccagggcatgctctctccggccgtctgttacgccgctctg
aaagtgggcgtgaccgatgtcgtgcgcctgggcggagcgcaggcggtcgccgcgctggcc
tacggcacggccagcgtgccccgcgctgacaagattttcgggcctggcaacgcctacgtg
acggcggccaaaaccctggcaagcgctgaagcgggcggccccgccatagacatgcccgcc
ggcccctccgagctgctggtggtggccgatgccagcgcccaggccgcctgggctgccgcc
gacctgctgtcccaggccgagcacggccccgattcgcaggtggtgctggtcagccccgag
cgccgcgtgctggaagcggtgcgccgtgaactggcccggcaactggccaccctcccccgg
caggacaccgcggcccgcgccctggcccggagccgcctgattctgaccgccagcctggac
gaagccgtgcaggtggcggacgagtacgcccccgagcacctcagcctgcaggtgaccgac
ccgcaggccctgagcggccgcatccgcgccggctcggtgttcgccgggcacctgacccca
gaagcgggcggggactacgccaccggcaccaaccatgtgctgcccacctacggcgcggcg
cgggccttttccagcctgggcctggccgacttctaccgccgctacaccgtgcagaccgtg
acggccgccggcctggaggcgctggcccccaccgtgaccgccctggcgcgcgaagaaggc
ctggaagcccacgcccgcgccgccgaagtgcgcctgaaccacatcccaggagaaaatgca
tga

DBGET integrated database retrieval system