KEGG   Deinococcus proteolyticus: Deipr_2105Help
Entry
Deipr_2105        CDS       T01426                                 

Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
dpt  Deinococcus proteolyticus
Pathway
dpt00260  Glycine, serine and threonine metabolism
dpt00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dpt01100  Metabolic pathways
dpt01110  Biosynthesis of secondary metabolites
dpt01130  Biosynthesis of antibiotics
dpt01230  Biosynthesis of amino acids
Module
dpt_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dpt00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Deipr_2105
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Deipr_2105
Enzymes [BR:dpt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Deipr_2105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth CHASE NanE ThiG
Motif
Other DBs
NCBI-ProteinID: ADY27235
UniProt: F0RQ33
Position
pDEIPR01:complement(96340..97155)
Genome map
AA seq 271 aa AA seqDB search
MSRYGKVFAGLRERGEGAFVPFVTLGDPDIETSERIIRTLLDAGADALELGLPFSDPVAD
GPTIQAANIRALAAGAGLTAGLNIIRRVRADYPDVPVGLLVYANLVESFGLDEFYGGVAA
VGADSVLVADVPLREGARFQAAAARHGVAPIFIAPPDASEERLRGVARESRGYVYLLARA
GVTGTEGGTARPADAVVRTLRDAGAPPTLLGFGIASPEHVRAALDAGADGAISGSAVVRI
IEQHQGDEAAMLAHLRDFVQEMKAATRPGAG
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgagccgctacggcaaggtgttcgccggcctgcgtgagcggggcgaaggcgctttcgtg
ccgttcgtgacgctgggcgacccggacatagagacgagtgaacgcatcatccgcaccctg
ctggacgccggggccgacgcactggaactgggcctccccttttccgacccggtggccgac
ggtcccaccatccaggccgccaacatccgggcactggcggcgggcgcgggcctgaccgca
gggctgaacatcatccggcgggtgcgggccgactacccggacgtgccggtgggcctgctg
gtctacgccaacctggtggaatcgttcgggctggacgagttctacggcggcgtggcggcc
gtgggcgccgactcggtgctggtggccgacgtgccgctgcgcgagggagcacgctttcag
gcggcggcggcgcggcacggggtcgcgcccatcttcatcgccccgcccgacgccagcgag
gagcgcctgcgcggcgtggcccgcgagtcacgcggctatgtgtacctgctggcccgcgcc
ggcgtgactggcaccgaggggggcacggcccgcccagcggacgcagtggtccgcaccctg
cgggacgcgggcgcaccgcccaccctgctggggttcggcattgccagccccgagcacgtc
cgggctgccctggacgccggcgcggacggggccatcagcggctcggcggtggtccgcatc
atcgaacagcatcagggcgacgaggccgccatgctggcccacctgcgcgacttcgtgcag
gagatgaaggccgccacccggccgggcgcaggctga

DBGET integrated database retrieval system