KEGG   Deinococcus proteolyticus: Deipr_2105Help
Entry
Deipr_2105        CDS       T01426                                 

Definition
(GenBank) Tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
dpt  Deinococcus proteolyticus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dpt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Deipr_2105
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Deipr_2105
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Deipr_2105
Enzymes [BR:dpt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Deipr_2105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
pDEIPR01:complement(96340..97155)
Genome map
AA seq 271 aa AA seqDB search
MSRYGKVFAGLRERGEGAFVPFVTLGDPDIETSERIIRTLLDAGADALELGLPFSDPVAD
GPTIQAANIRALAAGAGLTAGLNIIRRVRADYPDVPVGLLVYANLVESFGLDEFYGGVAA
VGADSVLVADVPLREGARFQAAAARHGVAPIFIAPPDASEERLRGVARESRGYVYLLARA
GVTGTEGGTARPADAVVRTLRDAGAPPTLLGFGIASPEHVRAALDAGADGAISGSAVVRI
IEQHQGDEAAMLAHLRDFVQEMKAATRPGAG
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgagccgctacggcaaggtgttcgccggcctgcgtgagcggggcgaaggcgctttcgtg
ccgttcgtgacgctgggcgacccggacatagagacgagtgaacgcatcatccgcaccctg
ctggacgccggggccgacgcactggaactgggcctccccttttccgacccggtggccgac
ggtcccaccatccaggccgccaacatccgggcactggcggcgggcgcgggcctgaccgca
gggctgaacatcatccggcgggtgcgggccgactacccggacgtgccggtgggcctgctg
gtctacgccaacctggtggaatcgttcgggctggacgagttctacggcggcgtggcggcc
gtgggcgccgactcggtgctggtggccgacgtgccgctgcgcgagggagcacgctttcag
gcggcggcggcgcggcacggggtcgcgcccatcttcatcgccccgcccgacgccagcgag
gagcgcctgcgcggcgtggcccgcgagtcacgcggctatgtgtacctgctggcccgcgcc
ggcgtgactggcaccgaggggggcacggcccgcccagcggacgcagtggtccgcaccctg
cgggacgcgggcgcaccgcccaccctgctggggttcggcattgccagccccgagcacgtc
cgggctgccctggacgccggcgcggacggggccatcagcggctcggcggtggtccgcatc
atcgaacagcatcagggcgacgaggccgccatgctggcccacctgcgcgacttcgtgcag
gagatgaaggccgccacccggccgggcgcaggctga

DBGET integrated database retrieval system