KEGG   Deinococcus proteolyticus: Deipr_2106Help
Entry
Deipr_2106        CDS       T01426                                 

Definition
(RefSeq) Tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dpt  Deinococcus proteolyticus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dpt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Deipr_2106
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Deipr_2106
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Deipr_2106
Enzymes [BR:dpt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Deipr_2106
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pDEIPR01:complement(97152..98435)
Genome map
AA seq 427 aa AA seqDB search
MTTQTSPASAPSPGGQPRLPAYFGEFGGQFVPEILLPALDQLEAEFIAAQQDPDFQAEFR
ALLKDYLGRPTPLTECRHLPLEGAARIFLKREDLLHGGAHKTNQVLGQALLAKRMGKKRV
IAETGAGQHGTATALACALMGLDCTVYMGAKDVARQQPNVFRMELMGARVVPVDAGSGTL
KDAVNEALRDWTASYDTTHYLLGTAAGPHPFPTIVREFHRMISEEAKAQMLERIGRLPDE
VIACVGGGSNAIGMFADFIDEPGVRLTGVEPAGEGLDSGRHGAPIYGGKVGILHGSRTFV
MRTAEGQVEESHSVSAGLDYPGVGPQHAYLQASGRAQYVGITDAEALEAFGLLSRHEGII
PALESAHALAYALKVAKDAPAGTALLVNLSGRGDKDIDHVQTLLPRAEGVSAASRLAGAP
ATAGGGA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaccacccagacttcacctgcctctgctccctcgcccggcggccagccacgcctgccg
gcctacttcggcgagttcggcggccagttcgtgcccgaaatcctgctgcccgcgctggac
cagctggaggccgaattcatcgccgcgcagcaagaccccgacttccaggccgaattccgc
gccctgctcaaagactacctgggccgccccaccccgctgaccgagtgccggcacctgccg
ctggagggcgcggcgcgcatttttctcaagcgggaagacctgctgcacggcggcgcccac
aagaccaatcaggtgctgggccaggccctgctcgccaagcggatgggcaaaaagcgcgtg
attgccgaaaccggcgccgggcagcacggcaccgccacggccctggcctgcgccctgatg
ggcctggactgcacggtctacatgggcgccaaagacgtggcccgccagcaacccaacgtg
ttccgcatggagctgatgggcgcgcgggtcgtgccggtggacgcgggcagcggcaccctc
aaggacgccgtgaacgaggcgctgcgcgactggaccgcctcgtacgacaccacccattac
ctgctgggcaccgccgccgggccgcacccctttcccaccatcgtgcgcgagtttcaccgc
atgatttccgaggaagccaaggcacagatgctggagcgcatcggccggctgccagacgag
gtgattgcctgcgtgggcggcggctccaacgccatcggcatgttcgcggactttatcgac
gagccgggcgtgcggctgactggggtggaaccggccggggaagggctggacagtggccgc
cacggcgctcccatctacggcggcaaggtgggcatcctgcacggctcgcgcaccttcgtg
atgcggaccgccgaggggcaggtggaagaatcgcactcggtgtcggcggggctggattat
cccggtgtggggccgcagcacgcctacttgcaggcctcgggccgggcgcagtacgtgggc
atcaccgacgccgaggcgctggaagccttcgggctgctcagccggcacgagggcatcatc
cccgcgctggaatcggcgcacgcgctggcctatgcgctcaaggtcgccaaagacgcgccg
gcaggcaccgcgctgctggtgaacctgtcgggccggggcgataaggacattgaccatgtg
cagacattgctcccgcgagcggagggagtctcggcggcaagccgccttgccggtgcacct
gccacagcgggaggcggggcatga

DBGET integrated database retrieval system