KEGG   Deinococcus proteolyticus: Deipr_2107Help
Entry
Deipr_2107        CDS       T01426                                 

Definition
Indole-3-glycerol-phosphate synthase., Phosphoribosylanthranilate isomerase (EC:4.1.1.48 5.3.1.24)
Orthology
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
dpt  Deinococcus proteolyticus
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:dpt01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:dpt00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pDEIPR01:complement(98498..99853)
Genome map
AA seq 451 aa AA seqDB search
MSEVLKRIVAGRRGHLPELRGRYSDLSAEGLPPSTRSLKAALTSPQSAFILECKSASPSL
GAIRAEYRPHELARIYSRYGSAISVLTEPDHFGGSYAHLSAVALSTHLPVLCKDFIVDEV
QILAARYHGADAILLMLSVLDDSDYRRLAALAHSLNLDILTEVSSEEEMSRAAALGAEII
GINHRDLRDLSIDLSRSARLAPLAPAGAVLVAESGLKDNRTVRRIAPHVHGFLVGSSLCG
EADVDRAARRLIYGEHKVCGLTRPEAAQVAAAAGAVYGGLIFAPGSPRRVSLEQARAITA
AAPELDYVAVYTGHDPAEAAALAQELPLHAVQLHGRQDDAFVTALRERLPAGVQLWYALD
MAASQPRPGMPVDRFVLDSGPGGTGQVFDWTQIPADLRDRSLLAGGLNPANAAAALQTGV
PGLDFNSGLEREKGVKDAGLIAQVFTALRAY
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagtcctcaagcgaatcgtggcgggccggcgcgggcacctgcccgagctgcgc
gggcgctactccgacctaagcgcagaggggctgccgcccagcacccgcagcctgaaagcc
gcgctgacttcgccgcagagcgcctttattctggagtgcaagagcgccagccccagcctg
ggcgccatccgcgccgagtaccgcccacacgagctggcccgcatctactcgcgctacggg
tctgccatctcggtcctgaccgagccggatcacttcggcggcagctacgcgcacctgagc
gctgtggccctgtccacccatctgccggtgctgtgcaaagacttcatcgtggacgaggtg
cagattctggccgcccgttaccacggcgccgacgccattttgctgatgctgtcggtgctg
gacgacagcgactaccgccgcctggccgcgctggcccactcgctgaacctggacatcctg
accgaggtgagcagcgaagaggagatgtcccgcgccgccgcactgggggccgaaattatc
ggtatcaaccaccgcgacctgcgcgacctgagcatcgacctgagccgctcggcacggctg
gctccactggccccggcgggcgccgtgctggtggccgaatcaggcctcaaggacaaccgc
acggtgcgccgcatcgctccccacgttcatggctttctggtgggcagcagcctgtgcggc
gaggccgacgtggaccgcgccgcccgccggctgatctatggcgagcacaaggtctgcggg
ctgacccgccccgaagctgcccaggtggccgccgctgccggggccgtgtacggcgggctg
attttcgcgcctggctcgccgcgccgcgtcagtctggagcaggccagggccatcaccgcc
gccgcgccggagctggattacgtggcggtctacaccggccatgaccctgccgaggccgcc
gcgctggcgcaggagctgcccctgcacgccgtacagctgcacggccgccaggacgacgct
tttgtcacggcgctgcgtgagcggctcccggcgggcgtccagctctggtacgcgctcgac
atggccgccagccagccccgccccgggatgcccgtagaccgcttcgtgctggacagcggc
ccgggcggcaccggccaagtgttcgactggacgcagattcccgccgacctgcgtgaccgc
tcgctgctggctggcggcctgaaccccgccaacgccgccgctgctctgcagaccggcgtg
cccggcctggacttcaactccggcctggagcgggaaaaaggcgtcaaggacgcgggcctc
atcgcccaggtgttcacggcgctgcgggcttactag

DBGET integrated database retrieval system