KEGG   Deinococcus proteolyticus: Deipr_2130Help
Entry
Deipr_2130        CDS       T01426                                 

Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
dpt  Deinococcus proteolyticus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dpt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Deipr_2130
Enzymes [BR:dpt01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Deipr_2130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pDEIPR01:complement(126244..127680)
Genome map
AA seq 478 aa AA seqDB search
MTDDTAQNDPLSTAPTVPLPTVQLPTAPHTAAAGNPSQQAGELPVIVVGGGLTGLSAAWE
LQQQGVPYVLLEAGDYLGGKVQTELWDDFLVEKAADAFVLGKPWALELAREVGLEPELIH
PREDTKRLYFLKGGQLLPFPEHLRMFVPLDEEAFRRSGVLSPEGTERMLAEVNVPPRENA
DEDESLASFIQRRFGEEAMNFIVPMAAGIYVANPHELSMQMAFPQFLAMEQKYGSLIAGH
RALPPRTTPVFGSFRGGMSELPRAVGRALTGEVRLNTPVQQVHADGVTLAGGQRLRGRGV
VVTAPAWFSGPMLSHDFPQAAELIQALKTNSSVAVILAYREDQFAADMNIHGLQVDWSEG
IPMTAITVHSGKMHGRAPQGHVLLRVFFKNTEPGEARRLAEKYVQELFGVTGEPLFHAFG
DWRGKNPAYVVGHLDHLAAIRAALPAQVQVAGASFTGVGLPDCVNAGRTAARAVLAQG
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatgacactgcccagaacgaccccctctccaccgcgcccactgtgcccctgccc
actgtgcagctgcccacggcaccgcacactgccgcagcggggaaccccagccagcaggcc
ggcgagctgccggtcatcgtggtgggcggcggcctgaccgggctgagtgccgcctgggag
ctgcagcagcagggcgtgccgtacgtgctgctggaagccggcgattacctgggcggcaag
gtccagaccgagctgtgggacgacttcctggtggagaaggccgccgacgccttcgtgctg
ggcaagccctgggcgctggagctggcccgcgaggtgggcctggaacccgagctgattcac
ccccgcgaggacaccaagcggctgtacttcctgaaaggcggtcagctgctgcctttcccc
gaacacctgcggatgttcgtgccgctggacgaggaagcctttcgccgcagcggcgtgctg
agcccggaaggcactgagcggatgctggccgaggtcaacgtgccgccccgcgagaatgcc
gacgaggacgagtcgctggcgtcgtttatccagcggcggtttggcgaggaagccatgaac
ttcatcgtgccgatggccgccggcatctatgtcgccaacccgcatgaactgagcatgcag
atggcgttcccgcagttcctggcgatggagcagaaatacggcagcctgattgccgggcac
cgggcgctgccgccgcgcaccacgccggtgttcgggtcgttccggggcggcatgagcgag
ctgccccgcgccgtgggccgggccctgaccggcgaggtgcggctgaataccccggtgcag
caggttcacgcagacggtgtgacgctggcgggcggccagcgcctgcgcgggcgcggcgtg
gtggtcacggccccggcctggttcagcgggccgatgctgagccatgattttccgcaggcc
gccgaactgattcaggccctgaaaaccaactccagcgtggccgttatcctggcctaccgc
gaggatcagtttgccgccgacatgaacattcacggcctgcaggtggactggtcggaaggc
attcccatgactgccatcaccgtacattcgggcaagatgcacggccgcgcaccgcagggg
catgtgctgctgcgcgtgtttttcaagaacaccgaacctggcgaggcccgccggctggcc
gaaaagtacgtgcaggagctgttcggcgtgaccggggaaccgctgttccacgctttcggg
gactggcgcggcaagaacccggcctatgtggtggggcatctggaccacctcgccgctatc
cgggcggcgctgccggcccaggtgcaggtggccggagccagctttaccggcgtgggcctg
cccgactgcgtcaacgccgggcgcacggcggcgcgggcggtactggcacagggctga

DBGET integrated database retrieval system