KEGG   Deinococcus proteolyticus: Deipr_2351Help
Entry
Deipr_2351        CDS       T01426                                 

Definition
helicase, RecD/TraA family (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
dpt  Deinococcus proteolyticus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dpt00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Deipr_2351
Enzymes [BR:dpt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Deipr_2351
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pDEIPR02:54547..56700
Genome map
AA seq 717 aa AA seqDB search
MTQTFKANGTVVQVRYVSDDKEYCVITADLIIEGVAIPDATVVGHMPVIDVYDGFEAELT
KEKNARWGYQYRALRLTPTGKPGQLDRGSIAAFFQYNFKGIGPKIGKALADEFGNGVFDL
LDKDPEKLLSIKGITRTVYAGITEGWKSYRAAHLNIIGLQQLGLSPRLANRVQHHLGHTA
LEQLEVDMYTLMRVEGIGFGMADRLALERGYAANDPRRLSAAARHALETAEQSQGHTYLP
HSRVIGGIQHFTGCTEQEAEAALTMTTDAGHIISETYEGEERALYLKSTWKQEVELAKHI
TELLSTPPQSNWSIPADIGKHLSEEQRAALELPANHRLCILTGGPGTGKTTTVGAMLKVA
HHSRLSVALAAPTGKAAKRLEETTGQEAVTIHRLLGSTGKDFYHNEHCPLNVDVLIVDET
SMMGQSLSYHLLAATGRGTRVILLGDAAQLPPVEAGEPLNNLLHLVPTATLTQVFRQAAK
NPIISAAHALQSGQAPDFPENAAPANHLLNHTEARAERLPDVVCQLVASLGGPSKAQILA
PMKKGPAGTEALNEAMQAHFNPARGRQEITIAGSTCRSGDPVVQTRNNYDLGIFNGMIGE
VIEVKDKEMKVIFDGEVITIKGKEAFDLQLAYALTIHRSQGSEWPVVIGVLSDVHGRMLT
RNLAYTALTRAKESFHSAGQRHAWTRAAGQQQLKRLTKLRTRVERNLAPDQPDLQAP
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgactcagacattcaaagccaatggcaccgttgtgcaggtacgctacgtttcagacgat
aaagagtattgcgtcatcacggccgacctcatcattgaaggcgtagccataccagatgcc
acagtggtggggcacatgccggtcatcgatgtgtacgacggcttcgaggccgaacttaca
aaagagaaaaacgcacgctggggataccagtaccgtgccctgcggctgacacctacgggc
aaacccggtcaactggacaggggcagcatcgcggctttttttcagtacaacttcaaaggc
ataggacccaagatcggcaaagccctggccgacgaattcggcaatggtgtatttgacctg
ctggataaagatccagaaaaactcttaagtatcaagggcatcacccgcacggtgtatgcc
ggcatcaccgaagggtggaaaagctaccgcgccgcccacctcaacatcattggacttcag
caactgggactgtcacccagactggccaaccgggtacaacaccacctgggacacaccgca
ctcgaacagcttgaagtcgacatgtacacgctgatgcgtgtcgaaggcatcggctttggc
atggcagaccggctggcactggagcgggggtacgctgcaaacgacccgcggcggctgagc
gcagcagcccggcatgccctcgaaacagccgagcagtcgcagggccacacctacttgcct
cactcccgcgtgataggaggcattcaacacttcacgggctgcaccgaacaagaagccgaa
gcggcgctgaccatgaccacagatgcggggcacatcatctcagaaacctatgagggagaa
gaaagggccctgtacctcaaatccacatggaaacaggaagtcgagcttgccaaacacatc
acggaactgctcagcacgccacctcagagcaattggagcattccagcagacatcggcaag
cacctgtctgaggagcagcgggccgcgctggagttgccggccaaccaccgcctgtgcatc
ctgaccggcggacccggtaccggtaaaaccaccactgtgggagccatgttaaaagtggcc
catcactcgcgcctcagtgtggccctggccgccccaacaggcaaagcagcaaagcgtctg
gaagaaacgactggccaagaagctgtgacgattcaccgtctgctgggcagcacaggaaag
gacttttaccacaacgagcactgcccgctgaacgtggacgtattgatcgtcgatgaaacc
tcaatgatgggccagtcgctgagttaccaccttctggcagccaccggacgcggcacacgg
gtcatcctcctcggcgacgcggcacagctgccccccgtcgaagccggtgaaccgctgaac
aacctgcttcatctggtcccaacagccacactaacccaggtcttccggcaagccgccaag
aaccccatcatcagcgccgctcacgccctgcaaagcgggcaagccccagacttcccagag
aatgcagcgcccgccaaccacttgctcaaccacaccgaagcgcgcgctgaacgtctgcct
gacgtggtctgtcaactggtcgcctccctgggcggccccagcaaggcccagatcctggca
ccgatgaaaaaaggacctgcgggaaccgaagccctgaacgaagcgatgcaggcccatttc
aatccggcccggggacggcaagaaatcacgattgccggcagcacctgccgcagcggtgat
cctgtcgtgcagaccagaaacaattacgacctcgggatcttcaatggcatgatcggtgaa
gtcatagaggtcaaagacaaagaaatgaaggtgatcttcgacggggaagtgatcaccatc
aaaggcaaggaggcctttgatctgcagctcgcttacgccctgacaattcaccgctcacaa
ggcagcgagtggcctgtggtaatcggcgtcctcagtgacgttcacggacgaatgctgaca
cgtaatctggcttacactgccctcacccgtgccaaagagagcttccattcagccgggcaa
cgtcatgcctggacccgcgccgccggacagcagcaactcaaacgactgaccaagctgcga
acacgggttgaacggaacctcgcgccagaccaaccggatttacaggcaccatga

DBGET integrated database retrieval system