KEGG   Deinococcus proteolyticus: Deipr_2540Help
Entry
Deipr_2540        CDS       T01426                                 

Definition
Alkaline phosphatase (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
dpt  Deinococcus proteolyticus
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dpt00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:dpt00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:dpt02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pDEIPR03:complement(26640..28223)
Genome map
AA seq 527 aa AA seqDB search
MPRHTTDGQLSRRAFLQAAAIITGAGLVSLSGCAPALQLRYPANPFQLGVASGDPQADSV
VLWTRLSLDPLGPTGAGLPAQAIDVTWELAHDEGFRQVVKQGRSPATPERDYAVHAEVYG
LEPQRTYFYRFHSGNATSPVGRTRTLPRAQDDVNALTLAFVSCSDYQNGYFNAYRHLAED
DPDLVLHLGDYIYEYGPNEKGVRQHNGPEIVTLEDYRRRYALYHADPDLQAAHAAAPWLV
VWDDHEVENNYAGAIMEAREEGEAPVTPEQFLARRAAAYQAYYENLPLRRSSMPRGADMQ
LYRRFTYGQLASFSMLDTRQYRSDQPCGDGFKAPCAAIMDPNATLTGPEQERWLLEGLQQ
SQARWNAIGQQVMMARYDWPFGPGEVLNMDQWDGYHAARQRLLGFMAQGQVSNPVVLTGD
IHSAWVHDLKADFLKPESATVGTELVTTSISADFPAQFVAPTAGGLKDNPHTRYFNGAQR
GYARAHITRDTWQTDFRVVDTIASRKSAVRTDASWVIEHGRPGAQRA
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgcccaggcacactacagacggacagctgtcccgccgcgctttcttgcaggcagcggcc
atcatcacaggggccggactggtcagcctgagcggctgcgccccggccctgcaactgcgc
tacccggccaacccttttcagctgggcgtggccagcggcgacccacaggccgatagcgtg
gtgctgtggacccggctctcgctggaccccctaggcccgaccggcgctgggctgccggcc
caggcgattgacgtgacctgggaactggcccacgacgagggcttccggcaggtggtgaag
cagggccgctccccagccacgccggagcgcgactacgccgtacacgccgaagtgtatggt
ctggagccgcagcgaacctacttttaccgcttccactcgggcaacgcgaccagtccggtg
ggccgcacccgcacgctgccccgggcccaggacgacgtgaacgccctgaccctggccttc
gtctcatgctcggattaccagaacggatatttcaacgcctaccgccacctggccgaggac
gaccccgacctggtcctgcacctgggcgactacatctacgagtacggcccgaacgaaaaa
ggcgtgcggcagcacaacggcccggaaatcgtgacgctggaggactaccgccgccgctac
gcgctgtaccacgccgacccggacctgcaggccgcgcacgccgctgccccctggctggtg
gtctgggacgaccacgaggtggagaacaactacgcgggagccatcatggaagcccgcgaa
gaaggggaggccccggtcacgcccgagcagtttctggcccggcgcgccgccgcctatcag
gcctactacgagaacctgccgctgcggcgctccagcatgccgcgtggagcggacatgcag
ctgtaccgccgcttcacctacggacagctggccagcttctccatgctagatacccggcag
taccgcagcgaccagccgtgcggcgacgggttcaaggctccctgcgccgccatcatggac
ccgaacgccaccctcaccggccctgaacaggagcgctggttgctggagggcctgcagcag
tctcaggcccgctggaacgccatcggccagcaggtgatgatggcccgctacgactggccc
ttcggtcccggcgaggtgctgaatatggaccagtgggacggctaccacgcagcccgccag
cgcctgctgggctttatggcgcagggacaggtgagcaacccggtggtcctgaccggcgac
atccactcggcctgggtccacgacctgaaggccgacttcctgaagcccgaatcggccacg
gtgggcaccgaactggtgaccacgtccatcagcgccgatttccctgcacagttcgtggcc
ccgacggcgggcggcctcaaggacaatccccacacgcgctatttcaacggagcgcagcgt
ggctacgcccgcgcccacattacccgcgacacctggcagaccgatttccgggtggtggac
accatcgccagccggaagtcggccgtacggaccgacgccagctgggtgattgagcacggc
cggccaggggcgcagcgggcctga

DBGET integrated database retrieval system