KEGG   Daphnia pulex (common water flea): DAPPUDRAFT_128507Help
Entry
DAPPUDRAFT_128507 CDS       T04347                                 

Definition
(GenBank) hypothetical protein
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
dpx  Daphnia pulex (common water flea)
Brite
Enzymes [BR:dpx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     DAPPUDRAFT_128507
Peptidases [BR:dpx01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   DAPPUDRAFT_128507
Exosome [BR:dpx04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   DAPPUDRAFT_128507
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Hydrolase_4 Abhydrolase_6 Abhydrolase_3 Abhydrolase_2 DUF900 Say1_Mug180 PGAP1 DUF676 Lipase_2
Motif
Other DBs
NCBI-ProteinID: EFX79540
JGI: Dappu1_128507
UniProt: E9GLP6
Position
Unknown
AA seq 308 aa AA seqDB search
MPSVVGVVAVILFILYVVLPLIFRYSPAFQRQLVFLPYTMNYSQPELHGLSGTRNFYMST
EPKISVGVWHILPGNLTDKSFKTIEESLACGNPVVLYLHGNSGSRATGHRVELYKLLKSL
NYHVISFDYRYSSNVVMSENGAVTDATRLYQYIRKFSGKSKVIVWGHSLGTAVGTKMVAQ
LCAVNQPPDGLILESPFNNISDVFRNHPLTILYRPLSVVDRFFTERLQSNNVAFDSDVHI
AGVECPTLILHARDDPIVPVFLTKKLYEAGLKSRPAEWSPLQIVEFHEDLNCGHEYICRV
PQLPSIIE
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgccgtctgtcgtcggagtagtggccgtcattctcttcattctctacgtcgtattgccc
ttaatatttcggtattctccggctttccagagacaacttgtgttcttgccctacaccatg
aattacagccaacctgagctacacggactgagtgggacgagaaatttttacatgtccaca
gagccgaaaatatccgtgggtgtttggcacattctaccgggaaacttgactgacaaatct
ttcaaaaccatcgaagagagtttagcttgcggaaatccggtcgtactttacttgcacggt
aattccggctcaagagccactggccatcgtgtagaactctacaaacttctcaaatctctt
aattatcacgtgatatctttcgattaccgatattcgtccaatgtcgtaatgtcagaaaat
ggagccgtcacggacgccactcgactttaccaatacattcgaaaattctccgggaaatca
aaagtgattgtatggggtcattcgctcggtaccgcagtgggcaccaagatggtagcccaa
ttgtgcgcagtcaaccagccacctgacggtttgattttggaatcgccgttcaacaatatc
agcgacgtgtttcgaaatcacccgctaactatcctctatcggccattgtccgtcgtcgac
cggttcttcaccgagaggctgcaaagtaacaacgtggcgtttgacagcgacgttcacatc
gccggcgtcgagtgccccacccttattctccatgcaagggatgatcctattgtgcccgtt
ttcctaaccaaaaagctctacgaggcggggctgaaatcccggcctgctgaatggtctcca
ttacagatcgtcgaattccacgaggacctgaactgcggccatgaatacatttgccgagtt
cctcaattgccttccattatagagtaa

DBGET integrated database retrieval system