KEGG   Daphnia pulex (common water flea): DAPPUDRAFT_304503Help
Entry
DAPPUDRAFT_304503 CDS       T04347                                 

Definition
(GenBank) hypothetical protein
  KO
K01054  
acylglycerol lipase [EC:3.1.1.23]
Organism
dpx  Daphnia pulex (common water flea)
Pathway
Glycerolipid metabolism
Metabolic pathways
Module
Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:dpx00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    DAPPUDRAFT_304503
Enzymes [BR:dpx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     DAPPUDRAFT_304503
Peptidases [BR:dpx01002]
 Serine Peptidases
  Family S33
   DAPPUDRAFT_304503
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 250 aa AA seqDB search
MVSKKSTNGGGHHTNPVPEQLRIKCGKKLHCRYWEPTVSPRGLVMLIHGLAEHLGCYEEL
GCRMAAENFLAFGHDHLGHGMSDGHRVHVESIDDYVVDILNHIQLMREEHPQIPIFAVGH
SMGGMILLSAALKEPTAFDGVVLMGPLIHIDPNLASPVKLWAARLLSRVTPHLAVSKLTV
EHITSDQGEQELIKNDPLVWKGGVKCKWATATHECLVEINKKLTSMKVPFAVLHAEQDKL
GAINNFQFIK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggtcagcaagaaatcaaccaacggtggcggacatcacaccaatccagtgccagagcaa
ttgcggatcaaatgcgggaagaaacttcactgccggtactgggagcccaccgtatcgccc
agaggtttggtcatgctgatccacggattagccgaacatttgggatgttacgaagagctg
ggctgccggatggccgccgagaatttcctggcattcggtcacgatcaccttggacacgga
atgagcgatgggcaccgcgttcacgtcgagtcgatcgacgactacgtcgtcgacatccta
aatcacatccagctgatgcgcgaagagcatccgcagatcccaatcttcgctgtcggacac
tcgatgggtggaatgattctcctgtcggctgcattgaaggagccaacggcattcgatggg
gtcgtcttgatgggaccgctgattcacatcgatccgaacctcgcttcgcccgtcaaactc
tgggccgccagattgctcagccgtgtgactcctcaccttgcggtgagcaaattgactgtt
gaacacattaccagcgatcaaggcgaacaggaattgatcaaaaacgatccactggtctgg
aaaggcggcgtcaaatgcaaatgggccacagcgactcatgaatgccttgtggaaattaac
aagaaactaacgtcgatgaaggtgcccttcgcggtcttacacgcggagcaagacaaatta
ggtgcaatcaataattttcaattcataaaataa

DBGET integrated database retrieval system