KEGG   Deinococcus radiodurans: DR_0032Help
Entry
DR_0032           CDS       T00025                                 

Definition
(RefSeq) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
dra  Deinococcus radiodurans
Pathway
dra00010  Glycolysis / Gluconeogenesis
dra00020  Citrate cycle (TCA cycle)
dra00620  Pyruvate metabolism
dra01100  Metabolic pathways
dra01110  Biosynthesis of secondary metabolites
dra01120  Microbial metabolism in diverse environments
dra01130  Biosynthesis of antibiotics
dra01200  Carbon metabolism
Module
dra_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dra00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DR_0032
   00020 Citrate cycle (TCA cycle)
    DR_0032
   00620 Pyruvate metabolism
    DR_0032
Enzymes [BR:dra01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     DR_0032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-GeneID: 1797460
NCBI-ProteinID: NP_293758
UniProt: Q9RYB8
Position
1:32248..33825
Genome map
AA seq 525 aa AA seqDB search
MKELLLPELAESVVEGEILKWLVEEGDAIALEQPLCEVMTDKVTVELPSPFEGTLHKRMA
NEGDVVAVHAVIALIDDGAGAGAGAIPSATQAIQDSAENPTTTEVTLPAQAEEEREAMGG
SIVEAGHIAKADDDSTSLFKTFANDEEVKVQGLGARSGSGAPGSSTAGTGTLDRAPETAP
ASPTPATANGGRVLAVPAARQAARELGIDLAAVRGSGPNGRIRVADVLAHQQSGQAQPQQ
TQPQQAAASQAVAPQPQAAAPAAPAPAGKLAAPSAHLPAPVQYRTPKGYEDRETRVPLRG
MRRAIANQMQASHLYTVRTLTVDEVNLTKLVEFRQRVKDEAKAADVKLSYLPFIFKAITV
ALKKYPSLNTSFDEATQEIVQKSYYNLGMAVATEAGLTVPVIRDVDRKSIFDLARDVVDL
AGRANAGKLSPDELTGSSFSVTNIGSIGALFSFPIINVPDAAIMGVHSIVKRPIVDEHDN
ITVAHMMYLSLSFDHRLIDGAEAARFCKEVIRLLENPDRLMLEGF
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaactgctgctgcccgaactcgccgaaagcgtcgtcgagggcgaaatcctgaaa
tggctggtggaggagggcgacgctattgccctcgaacagccgctgtgcgaagtgatgacc
gacaaggtgaccgtcgaactgccgagcccctttgagggcacgctgcacaagcgcatggcg
aacgagggcgacgtggtggccgtacacgccgtcatcgccctgatcgacgacggtgcgggt
gccggggccggagcaataccaagtgctacccaggccattcaggacagcgccgagaacccg
acgacgactgaagtgaccctgcctgcccaggcggaggaggagcgcgaggcgatgggcggg
agcatcgtggaagccgggcacatcgccaaggccgacgacgactcgaccagcctcttcaag
accttcgccaacgacgaggaggtcaaggtgcagggcctcggcgcccgttctggcagtggc
gcgcccggcagcagcacggcgggcaccgggacgctagaccgcgcaccggagactgccccc
gcttcccctacgcctgccactgcgaacgggggccgcgtcctcgccgtccccgccgcgcgt
caggcggcccgcgagctcggcattgacctcgctgcggtgcgcggcagtggccccaacggg
cgcattcgcgtggcggacgtgctcgcgcaccagcagagcgggcaggcccagccccagcaa
acccagcctcaacaggcggcggcctctcaagcagtggcccctcagcctcaagccgccgct
cccgctgccccggcacctgccggcaagctcgccgcgccctccgcgcacctgcccgccccg
gtgcagtaccgcacgcccaagggctacgaggaccgcgaaacccgtgtgccgctgcgggga
atgcgccgcgcgattgccaaccagatgcaggcgtcgcacctctacaccgtccgcaccctg
acggtggacgaagtgaacctgaccaaactggtcgagttccgccagcgcgtgaaggacgag
gccaaggccgccgacgtgaagctgtcgtacctgcccttcatcttcaaggccattacggtg
gcgctgaaaaagtaccccagcctcaacacgtccttcgacgaggcgacgcaggaaatcgtc
cagaagagctactacaacctcggaatggccgtcgccaccgaagccgggctgacggtgccg
gtcatccgcgacgtggaccgcaagagcatcttcgacctcgcccgcgacgtggtggacctt
gcgggccgcgccaacgcgggcaagctcagccccgacgaactcacgggcagctcgttcagc
gtgaccaacatcggcagcatcggcgcgctgttttcgttccccattatcaacgtgcccgac
gccgccatcatgggcgtccactccatcgtcaagcggcccatcgtggacgagcacgacaac
atcaccgtggcccacatgatgtacctctcgctgtcgttcgaccaccgcctgatcgacggc
gccgaagccgcccgcttctgcaaagaagtcatccggctgctcgaaaaccccgaccggctg
atgctcgaagggttctga

DBGET integrated database retrieval system