KEGG   Deinococcus radiodurans: DR_0036Help
Entry
DR_0036           CDS       T00025                                 

Gene name
folE
Definition
(RefSeq) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
dra  Deinococcus radiodurans
Pathway
dra00790  Folate biosynthesis
dra01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dra00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    DR_0036 (folE)
Enzymes [BR:dra01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     DR_0036 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-GeneID: 1799427
NCBI-ProteinID: NP_293762
UniProt: Q9RYB4
Position
1:36181..36831
Genome map
AA seq 216 aa AA seqDB search
MPQARGEGATPPTSLPNPSLKGVPLPDNPNNLEPLTREWLAAIGEDPDREGLQRTPQRVA
KAWAYMTEGYGQTLAQVVGEGVFAAEGSEMVIVKDIEFYSMCEHHMLPFYGRAHVAYIPG
TRILGLSKFARIVDLYSRRLQVQERITTQVADAVEELLAPKGVAVLMEGIHLCMAMRGVQ
KQNSSTTTSAMRGLFRSDPRTRAEFMSAVQGTLRGR
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
ttgccgcaggcaaggggtgagggggccaccccgccaacgtctctccccaacccttccctc
aaaggagtccccttgcccgacaacccgaacaacctcgaacccctcacccgtgagtggctt
gccgccatcggcgaagacccggaccgtgaagggcttcagcgcacgccgcagcgcgtcgcc
aaagcctgggcgtacatgaccgagggctacgggcagacgctcgcgcaggtggtgggcgag
ggcgtgtttgccgccgagggcagcgagatggtcattgtcaaggacatcgagttttattcg
atgtgcgagcaccacatgctgcctttttatggccgcgcccacgtcgcctacattcccggc
acccggattctgggcctgagcaaattcgcccgcatcgtggacctctactcgcgccgcttg
caggtacaggagcggatcaccacgcaggtggccgacgctgtggaagagctgctggccccc
aagggcgtggcggtgctgatggaaggcattcacctgtgcatggcgatgcgcggcgtgcaa
aagcagaacagctccacgacgacctcggccatgcgcggcctcttccgttccgacccgcgc
acccgcgccgagttcatgagcgctgtgcagggaacgctgcggggccgctaa

DBGET integrated database retrieval system