KEGG   Deinococcus radiodurans: DR_0083Help
Entry
DR_0083           CDS       T00025                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase, dihydrolipoamide succinyltransferase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
dra  Deinococcus radiodurans
Pathway
dra00020  Citrate cycle (TCA cycle)
dra00310  Lysine degradation
dra01100  Metabolic pathways
dra01110  Biosynthesis of secondary metabolites
dra01120  Microbial metabolism in diverse environments
dra01130  Biosynthesis of antibiotics
dra01200  Carbon metabolism
Module
dra_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dra_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dra00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DR_0083
  Amino acid metabolism
   00310 Lysine degradation
    DR_0083
Enzymes [BR:dra01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     DR_0083
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-GeneID: 1799401
NCBI-ProteinID: NP_293809
UniProt: Q9RY67
Position
1:complement(83069..84322)
Genome map
AA seq 417 aa AA seqDB search
MADIKVPVFSESVSEGTLLTWHKKPGEAVKRGELLAEIETDKVVLEVTAQQDGVLQSIAK
NEGDTVLSEEVLGTMGEGDAAAPAPAAQDQASGPVASETTAGGTAQQPDSTGTQPAAQSG
ERREDLSPAVRKIVEEKGLDVSQVPATGPKNNITKADAMGASAPAPAAQPAPQAAKSAVV
LPSGPRPEERVPMTRIRARIAERLKEVQNTAALLTTFNEVNMQPTMELRKKYQDQFVKKH
GVKLGFMSLFVRAATEALKAFPMVNASVDGKDVIYHGYYDIGIAVASERGLVVPILRDTD
NMSLADIEKQIAEFATRARAGKLTMEDMSGGTFSITNGGTFGSMMSTPIINAPQSAILGM
HNIIERPIAQNGQVVIAPMMYLAVSYDHRLIDGKEAVQFLVMIKNLLEDPARMLLDL
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggcggacatcaaagttcctgttttttccgaatcggtcagcgaaggcacgctgctgacc
tggcataagaaacccggcgaagcggtcaagcgcggtgagctgctggccgaaatcgagacc
gataaggtcgtgctggaagtcactgcccaacaagacggcgtgcttcagagcatcgccaag
aacgagggcgacaccgtgctgagcgaagaagtgcttggcacgatgggcgagggcgacgca
gcggccccggctcctgccgctcaggaccaggcgagcggcccagtggcgagcgaaaccacc
gccggcggcacggcgcagcagcccgacagcaccggcacccagcctgccgcccagagcggt
gagcgccgtgaagacctttcccctgctgtgcgcaagatcgtggaggaaaagggtctggac
gtgtcgcaagttccagccaccggccccaagaacaacatcaccaaggcggacgcgatgggc
gccagcgctcctgcacctgctgctcagcctgcaccccaggcagccaagtcggcggttgtg
ctgcccagcggcccccgtcccgaagagcgcgtgccgatgacgcgcatccgcgcccgcatc
gccgagcgcctcaaggaagtgcagaacacggcggcgctgctcaccaccttcaacgaagtg
aacatgcagcccaccatggagctgcgtaagaagtaccaggaccagttcgtgaagaagcac
ggcgtcaagctcggcttcatgagcctgttcgtacgcgcggccaccgaggccctcaaggcc
ttcccgatggtgaacgccagcgtggacggcaaggacgtcatctaccacggctactacgac
attggcatcgcggtggcgtctgagcgtggtctggtcgtgccgattctgcgcgacaccgac
aacatgagcctcgccgacatcgagaagcagattgccgagttcgccacccgcgcccgcgct
ggcaagctgaccatggaagacatgagcggcggcaccttctccatcaccaacggcggcact
ttcggctccatgatgagcacccccatcatcaacgcgccgcagagcgccatcctgggaatg
cacaacatcatcgagcgcccgattgcccagaacggtcaggtcgtgatcgccccgatgatg
tacctcgccgtgtcctacgaccaccgcctgatcgacggcaaggaagcggtgcagttcctg
gtgatgatcaagaacctgctggaagacccggcgcgcatgttgctggacctctga

DBGET integrated database retrieval system