KEGG   Deinococcus radiodurans: DR_0168Help
Entry
DR_0168           CDS       T00025                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
dra  Deinococcus radiodurans
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dra00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    DR_0168
Enzymes [BR:dra01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     DR_0168
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1:170861..171730
Genome map
AA seq 289 aa AA seqDB search
MNWTGRIHELTFGFPVPSAEKGPNGWTVRWPGCRVMGILNATPDSFSDGGQHLQLDAALA
TARRMRDTGVFILDIGGESTRPGAEPVDAATELDRVLPLIRALRGEHVLLSVDTMKPEVA
AEALRAGAHLVNDVTGLRDPAMIRVCADAGAAACVMHMQGEPRTMQHQPVYSDVVAEVHG
FLRERAAEVKSAGVPSVLLDPGIGFGKTLDHNLSLLRAVDDLASGPDPVLIAASRKKTID
LIAGVPEAADRDPGSLALHLHAARCGAALVRLHAAGEMVQALRVEAALA
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
gtgaactggacgggccgtatccacgagctgaccttcgggtttcccgtccccagcgcggag
aaaggcccaaacggctggacggtgcgctggccgggctgccgcgtgatgggcatcctcaac
gcgacgcccgacagtttcagcgacgggggccaacatctccaactcgacgcggcgctggcg
acggcccgccgaatgcgtgacacgggcgtcttcatcctggacatcggcggcgaaagcacc
cgccccggcgcggagccggtggacgcggcgaccgagctcgaccgggtgctgcccctcatc
cgcgccctgaggggcgaacacgtcctgctcagcgtggacaccatgaaacccgaagttgcc
gccgaggccctccgcgcgggcgcccacctcgtcaacgatgtgaccggcctgcgcgacccc
gccatgatccgtgtctgcgccgacgccggggccgccgcctgcgtcatgcacatgcagggc
gagccgcgcaccatgcagcaccagcccgtgtacagcgacgtggtggccgaggtccacggc
ttcctgcgcgagcgggccgcagaggtgaaatcggcgggcgtgccctccgtcctgctcgac
cccggcatcggctttggcaagacgctggaccacaacctgagtctgctgcgggccgtggac
gacctcgccagcggcccggaccctgtgctgatcgccgccagccgcaagaaaaccatcgac
ctcatcgcgggcgttccggaggccgccgaccgggaccccggaagcctcgccctgcacctc
cacgcggcccgctgcggcgcggcgctggtgcggctgcacgcggcgggcgagatggtgcag
gcgctgcgggtggaggcggcgctcgcctga

DBGET integrated database retrieval system