KEGG   Deinococcus radiodurans: DR_0170Help
Entry
DR_0170           CDS       T00025                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
dra  Deinococcus radiodurans
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dra00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1:172108..172623
Genome map
AA seq 171 aa AA seqDB search
MTRAFIALGANLGDPQATLRRALTELGALGEVRGVSALYRTAPVGGPPGQPDYLNAVAEL
ETALSAPALLAALHALEADAGRTRDVRWEARVLDLDLIVYGEDVSDDPALTLPHPRAWER
GFVLAPLSDLAPSLAHPRTGEMVAQALRRVDLAGVEVSELSLCWPELGSGE
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcgggcttttatcgcgctgggcgccaacctgggcgacccccaggccaccctgcgc
cgcgccctgaccgaactcggggccctcggcgaagtgcgcggcgtgtcggccctctaccgc
accgcgcctgtcggcggcccgcccggacagcccgactacctcaacgcggtggccgaactc
gaaacggccctgagtgccccggccctcctcgccgccctccacgccctggaagcagacgcc
ggacgcacccgtgacgtgcgctgggaagcccgcgtgctggacctggatttgattgtctac
ggcgaagacgtgtcagacgaccccgccctcacgctgccccacccccgcgcctgggagcgg
ggcttcgtcctcgcgccgctgagtgacctcgccccctccctcgcccacccgaggacaggg
gaaatggtggcgcaggcgctgcgccgggtggacctggcaggcgtggaggtcagtgagctt
tctctgtgctggccggagttagggtcaggcgaatga

DBGET integrated database retrieval system