KEGG   Deinococcus radiodurans: DR_0198Help
Entry
DR_0198           CDS       T00025                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
dra  Deinococcus radiodurans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dra00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    DR_0198 (recR)
DNA repair and recombination proteins [BR:dra03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      DR_0198 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Structure
PDB: 

Jmol
Position
1:complement(202133..202795)
Genome map
AA seq 220 aa AA seqDB search
MKYPPSLVSLIRELSRLPGIGPKSAQRLAFHLFEQPREDIERLASALLEAKRDLHVCPIC
FNITDAEKCDVCADPSRDQRTICVVEEPGDVIALERSGEYRGLYHVLHGVLSPMNGVGPD
KLHIKPLLPRVGQGMEVILATGTTVEGDATALYLQRLLEPLGAAISRIAYGVPVGGSLEY
TDEVTLGRALTGRQTVSKPQPPQRPGDEDGADGAAVPASR
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatccgccttccctcgtgtccctcatccgcgagctgtcacgcttgccgggcatc
ggccccaagagcgcgcagcgactcgcctttcacctgttcgagcagccgcgtgaggacatc
gagcgcctcgcctccgccctgctcgaagccaagcgcgacctgcacgtctgcccgatttgt
ttcaacatcaccgacgccgagaagtgcgacgtgtgcgccgaccccagccgcgaccagcgc
accatctgcgtggtggaagaacccggcgacgtgattgcgctggagcgcagcggcgagtac
cgggggctctaccacgtcctgcacggcgttctgagcccgatgaacggcgtcggccccgac
aagctgcacatcaagccgctgctgccccgcgtggggcaaggcatggaagtgattctggcg
actggcacaacggtggagggcgacgccaccgcgctctaccttcagcggctgctcgaaccg
ctcggcgccgccatcagccgcatcgcctacggggtgccggtgggcggctcgctggaatac
accgacgaggtgacgctgggccgtgcgctcacaggccgccagaccgtgagcaagccccag
ccgccgcaacgtcccggtgacgaagacggcgccgacggagcagcggtgcccgcatcccgc
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system