KEGG   Deinococcus radiodurans: DR_0229Help
Entry
DR_0229           CDS       T00025                                 

Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
dra  Deinococcus radiodurans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dra00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DR_0229
Enzymes [BR:dra01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     DR_0229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:228863..229990
Genome map
AA seq 375 aa AA seqDB search
MERVAVLCRHPRNSENCSRLHLMSDTPSPINRDFLFELLSQAAPSGAERRAADVWKKEAA
TFARVSEDHYGSVYAELGPENGPAIALMGHLDEIGLIVSHVDDKGHLSVLGVGGWDPQVL
VGQRIRLLAPGGDLLGVVGKKAIHVMEAEERTKASKLEDLWIDVGLDADEVKAKVPVGTY
GVIEQGPVMVGNKVVSRALDNRVGAFIVLEALRALKDVELKHRIVAVGTSQEEIGVFGAQ
TSAYRLDPVAGIAVDVTHETDQPGVSEKKYGVAPFGSGANLSVGPMTNPTLLRQLTEAAG
RENIPYTLSASGRYTGTDADALTLVRAGVPTGVVSIPNRYMHSPSEMVDERDVKACIDIL
AAWIRGLEETLEFTR
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggagcgggtggcggtgctctgccgacacccacgtaattcggagaactgctctagactg
cacctcatgtctgacactccgagtcccatcaaccgcgacttcctcttcgagctgctctcg
caagcggcccccagcggtgccgagcgccgcgccgccgacgtgtggaaaaaagaagcggcc
accttcgcccgcgtctccgaggaccactacggcagcgtgtacgccgaactcggcccggaa
aacggccccgccatcgcgctgatgggccacctcgacgaaatcggcctcatcgtctcgcac
gtggacgataagggacacctcagcgtccttggcgtgggcggctgggacccgcaggtgctt
gttggccagcgtattcggctgctcgcgcccggtggcgacctgctcggcgtggtcggcaaa
aaagccattcacgtgatggaagccgaggaacgcaccaaggcgagcaaactcgaagacctc
tggatcgacgtgggcctcgacgccgacgaagtgaaggccaaagtgccggtcggcacctac
ggcgtcatcgagcaggggccggtcatggtcggcaataaagtggttagtcgcgcactcgac
aaccgcgtcggcgcgtttatcgtgctcgaagccctgcgcgccttgaaagacgtggagctc
aagcaccgcatcgttgctgtgggcaccagtcaggaagaaatcggcgtgttcggcgcgcag
acgagcgcctaccgcctcgacccggtggcgggcatcgcggtggacgtgacgcacgaaacc
gaccagcccggcgtgagcgagaagaaatacggcgtggcccccttcggctcgggtgccaac
ctctcggtcggcccgatgaccaaccccacgctgctgcgccagctcaccgaggcggcgggc
cgcgagaacatcccctacaccctgtccgccagcgggcgctacaccggcaccgacgccgac
gcgctgaccctggtgcgcgcgggcgtgccgactggcgtggtcagcattcccaaccgctac
atgcacagccccagcgaaatggtggacgagcgcgacgtcaaagcttgcatcgacatcctc
gccgcctggattcgcggtctggaagagacgctggaatttacccgctga

DBGET integrated database retrieval system