KEGG   Deinococcus radiodurans: DR_0256Help
Entry
DR_0256           CDS       T00025                                 

Definition
pyruvate dehydrogenase complex, dihydrolipoamide acetyltransferase E2 component
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
dra  Deinococcus radiodurans
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dra00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DR_0256
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DR_0256
   00020 Citrate cycle (TCA cycle)
    DR_0256
   00620 Pyruvate metabolism
    DR_0256
Enzymes [BR:dra01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     DR_0256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(254721..256574)
Genome map
AA seq 617 aa AA seqDB search
MAAMVSHSSPVDGAPVSRPRSPVMATELKLPDVGDNIEKGTVVTVLVNPGDSVTEGQPII
EIETDKAVVEVPASAAGTIEAVNVKVGDTIPVGGVIATLGGGAASASDSAPSASAPSPAN
GGGDQAANVESTPATDSGTAQRVAQAQQDAQKEQAGQPTSGGTADANQAQATPSEGQSSG
GQQVTLPDVGDNIEKGTVVTILVNVGDTVSEGQPVIELETDKAVVEVPANASGTVQSVAV
KIGDSIPVGGTILTLSGAASTQPTAPAPESAQPASQSQQSTQPEPARPAGAPQAQAAAPQ
QSGTQNPQTFDGRPVVPAAPSVRRLAREIGIDIHAVHGTGIAGRISEEDVRRTAGTPSVQ
AQASAASAAAPAPMAAPLPNFEKWGTVRREDMSGIRKATVRSMTTAWTTIPMVTHFDKAD
VTAMEETRKRFGARVEKEGGKLTMTHILMKVVANALRKFPKFNASLDLGAEQVIYKEFVN
IGVAVDTPVGLLVPVVKDADRKGITELVLDLSELAGRARERKLKPDEMQGATFTISNLGG
IGGNAFTPIVNSPEVAILGVSRGGFEPVWNKEKGEFEPRNMLPLSLTYDHRLIDGADAAR
FLRYICESLEDPFLISL
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
gtggccgctatggtttcgcacagttccccggttgatggtgcacccgtcagccgtccaagg
agtcccgtcatggcaactgaactcaagctccccgatgtcggggacaacatcgaaaaaggc
accgtggtgacggtcctcgtcaaccctggcgacagcgtgaccgagggccagcccatcatc
gaaatcgaaaccgacaaggccgtggtcgaagtcccggcaagcgcggcgggcaccatcgaa
gccgtgaacgtcaaagtgggcgacaccatcccggtgggcggcgtgattgctaccctgggc
ggcggcgcagccagcgcttccgattctgcccccagcgccagcgcaccctccccggccaac
ggcggcggcgatcaggcggcgaacgtggaatccacgccggccaccgacagcggcaccgca
cagcgtgtggcccaggctcagcaggacgcccagaaagagcaggccgggcaacccacgagc
ggtggcactgccgatgcaaatcaggctcaggcaacgcccagcgaaggccagagcagcggc
ggccagcaggtcacgctgcccgacgtgggcgacaacatcgagaaggggacggtcgtgacc
atcctcgttaatgtgggcgacaccgtcagcgaaggccagccggtcatcgaactcgaaacc
gacaaggctgtcgtcgaagtcccggccaacgcgagcggcaccgtgcagagcgtggcggtc
aagatcggcgactccatcccagtcggcggcaccatcttgacgctgagcggcgcggcttct
acacaacctacggctcctgcacctgaaagtgctcaacccgcctcccagtcgcagcaaagc
acccagcctgagccagctcgtcctgccggcgctccgcaagcccaggccgccgcacctcag
cagtccggcacccagaacccccagaccttcgatggccgcccggtggttcccgctgcgccc
agcgtgcgccgcctggcgcgtgaaatcggcattgacattcacgctgttcacggcaccggc
atcgccggacgcatcagcgaagaagatgtacgccgcactgccggaacgcccagtgtgcaa
gcgcaggccagcgcagcaagcgccgctgctcccgcccctatggctgctcccctccccaac
ttcgagaagtggggcacggtccgccgcgaggacatgagcggcatccgtaaggccactgtc
cgcagcatgaccacggcctggacgaccatcccgatggtcacccacttcgacaaggccgac
gtgaccgccatggaagaaacccgtaagcgctttggggcgcgggtggaaaaggaaggcggc
aagctgaccatgacccacatcctgatgaaggtcgtggcgaacgccctgcgcaagttcccc
aagttcaacgccagcctcgacctcggcgccgaacaggtgatctacaaggagttcgtgaat
atcggcgtggctgtggacactccggtgggcctgctggttccagtggtcaaagacgccgac
cgcaaaggcatcaccgagctggtcctcgacctctccgaactcgctggccgcgcccgcgag
cgcaaactcaagcccgacgaaatgcagggcgcgacgttcacgatctccaacctcggcggt
atcggtgggaacgcttttacacccatcgtcaacagccccgaagtcgccatcctcggcgtc
tcccgtggcggctttgagccggtgtggaacaaggaaaagggcgagttcgagccgcgcaac
atgctgccgctcagcctgacctacgaccatcgcttgattgacggcgccgacgctgcccgg
ttcctgcgctacatctgtgagtccttggaagaccccttcctgatctcgctgtaa

DBGET integrated database retrieval system