KEGG   Deinococcus radiodurans: DR_0602Help
Entry
DR_0602           CDS       T00025                                 

Definition
(RefSeq) phosphoglycerate mutase-like protein
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
dra  Deinococcus radiodurans
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dra00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DR_0602
   01230 Biosynthesis of amino acids
    DR_0602
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DR_0602
  Energy metabolism
   00680 Methane metabolism
    DR_0602
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DR_0602
Enzymes [BR:dra01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     DR_0602
Exosome [BR:dra04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   DR_0602
  Exosomal proteins of melanoma cells
   DR_0602
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(614142..614738)
Genome map
AA seq 198 aa AA seqDB search
MNLTLLRHGRSRADDEGVCEGRYDSPLTEVGREHARKLAAYWAAHPPGFDQAYCSTLSRA
SETAALVTAPLGLVPMPSDLLREFDNGPIAGLPFAKAEARYPIPAFRHELEAFTVDGGES
QAAFRARALLALELVWRGGENVLVVAHGGILNAMLRELTGARRAHFAYGDTAFTTVQLSR
EHMGVTVTGVNLTPHLAE
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgaacctcactctgctccgacatggccgcagccgcgccgacgacgagggcgtgtgcgag
ggccgctacgactcgccgctgaccgaggtgggccgtgagcatgcgcgcaagctggcggct
tactgggccgcccacccgccgggctttgaccaggcttattgctcgactctcagccgggcg
agcgagacagcggccctcgtgacggccccactcgggctggtgccgatgccaagcgacctg
ctgcgcgagttcgacaatggccccatcgccgggctgccctttgccaaggccgaggcgcgc
tatcccattccggccttccggcacgagctcgaagcgttcacggtggacgggggcgagtcg
caggcggccttccgggcccgcgccctgctcgcgctggagctggtgtggcgaggcggcgag
aacgtgctggtggtcgcgcacggcggcatcctgaacgccatgctgcgcgagttgaccggt
gcgcggcgggcacacttcgcctacggcgacacggccttcacgaccgtgcagctcagccgc
gaacacatgggggtgaccgtgaccggcgtcaatctcacgccgcatctggcggagtga

DBGET integrated database retrieval system