KEGG   Deinococcus radiodurans: DR_0635Help
Entry
DR_0635           CDS       T00025                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dra  Deinococcus radiodurans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dra00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DR_0635 (pfkA)
   01230 Biosynthesis of amino acids
    DR_0635 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DR_0635 (pfkA)
   00030 Pentose phosphate pathway
    DR_0635 (pfkA)
   00051 Fructose and mannose metabolism
    DR_0635 (pfkA)
   00052 Galactose metabolism
    DR_0635 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    DR_0635 (pfkA)
Enzymes [BR:dra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     DR_0635 (pfkA)
Protein phosphatases and associated proteins [BR:dra01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     DR_0635 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1:complement(649693..650697)
Genome map
AA seq 334 aa AA seqDB search
MTQPDMAYPNPAGIKRVAVLTSGGDAPGMNAAIRAVVRTGAQQGIEVVGVRRGFSGLHRG
EVQLLGPRDVANTIQRGGTILLTARSHTWRSPEGRAKGAAVLREWGVDGLVVIGGDGSFH
GGYFLQEEHGIPVIGVPGTIDNDLYGTDHTIGYFTAVETALEAVDKLRDTGASHERIFVI
EVMGRHAGHIALDVAVAGGAEEVFIPEDKKPIGDVVNIVKDSIAKGKRGSIIIVAEGYDG
GAEAVAQAIHAGTGLETRVSILGHIQRGGTPVSSDRILASRLGEAAVYALMDGKKGVMVG
RIGGGIAYTPLHETWEKRKDVSRDLYRCAKMLSI
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgacccaacctgacatggcctaccccaaccccgccggcatcaagcgcgtggccgtcctg
acgagcggcggcgacgcgcccggcatgaacgccgccattcgcgccgtggtccgcacgggt
gcccagcagggcatcgaagtcgtcggcgtgcgccggggcttttccggcctgcaccggggc
gaagtgcagcttctgggcccgcgcgacgtggcgaacaccattcagcgcggcggcaccatt
ctgctcaccgcccgcagccacacctggcgctcgccggaaggccgggccaaaggggcggcg
gtgctgcgcgagtggggcgtggacggcttggtggtcatcggcggcgacggctcctttcac
ggcgggtactttttgcaagaggaacacggcatcccggtcatcggcgtgccgggcaccatc
gacaacgacctgtacggcactgaccacaccatcgggtacttcacggcagtggaaacggcg
ctcgaagcggtggacaagctacgcgacacgggcgcgagccacgagcgcatcttcgtcatc
gaggtgatgggccgccacgccgggcacatcgcgctcgacgtggcggtggcgggcggcgcc
gaggaagtctttattcccgaagacaaaaaacccatcggcgacgtggtgaacatcgtcaag
gacagcattgccaagggcaagcggggcagcatcatcatcgtggccgagggctatgacggc
ggcgccgaggcggtcgcgcaggccattcacgccggcaccggcctggaaacccgcgtcagc
atcctggggcacatccagcgtggcggcaccccggtcagctcggaccgcatcctggcgagc
cgactgggcgaagccgccgtctacgccctgatggacggcaaaaagggcgtgatggtgggg
cgcatcggcgggggcatcgcctacacgccgctgcacgaaacctgggaaaagcgcaaggac
gtgagccgcgacctttaccgctgcgccaagatgttgagcatttaa

DBGET integrated database retrieval system