KEGG   Deinococcus radiodurans: DR_0786Help
Entry
DR_0786           CDS       T00025                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
dra  Deinococcus radiodurans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dra00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    DR_0786
Enzymes [BR:dra01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     DR_0786
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1:800165..800938
Genome map
AA seq 257 aa AA seqDB search
MSSADSLPLQGHTVAVTRPDSGGDGGGGRLGELLRAQGAEVLSVPLIRFLPPADPRALWS
GLRDLRGVDWLLVTSPQGGRLLGEALAAAGVADLAGTRLAAVGEATARELRARGLPVDFL
PTTATALSLGRKLPAQPGQAALHLTSQLSENTLRGELAARGVTYRRLELYHTAPAVLNAA
ERVALAGVSAVTLASGSAAQGLAALAGPDFDPLRLPVAAIGEQTAAAAWTLGFVSVTTAP
QPSLEGLVAAAIKAVRS
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctgccgattccctccctctgcaaggccacaccgtcgctgtcacccgcccggac
agtgggggagacggcgggggcgggcgcctgggtgaattgctgcgggcgcagggggccgag
gtgctgagcgtgccgctgattcgctttttgccgcccgcagacccacgggcgctctggtcg
gggctgcgtgacctgcgcggcgtggactggctgctcgtcacgagtccgcaggggggccga
ctgctcggcgaggcgctggcggcggcgggcgtggcggacctcgccgggacgcggctggcg
gcggtgggcgaggcgacggcccgtgagttgcgtgcgcgtggattgccggtggactttttg
cccaccacagccaccgccctgagcctgggccgcaaactgcccgctcagcccggtcaggcc
gcgctacacctcacctcgcaactgtcggagaacaccctgcgcggcgaactggcggcgcgg
ggcgtgacttaccgccggttggagctgtaccacactgcgcccgccgtcctgaacgcggcg
gagcgcgtggccctcgcgggcgtgtccgccgtgaccctcgcttcgggcagcgcggcgcag
gggctggcggcgctggcggggccggactttgacccgctgcgcctgccagtcgcggccatc
ggtgagcagacggcggcggcggcgtggactttgggctttgtttctgtcaccacggcgccc
cagccctcgctggaaggtctggtcgcggcggcgattaaggctgtgcgttcctga

DBGET integrated database retrieval system