KEGG   Deinococcus radiodurans: DR_0823Help
Entry
DR_0823           CDS       T00025                                 

Definition
ROK family protein
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
dra  Deinococcus radiodurans
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dra00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DR_0823
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DR_0823
   00520 Amino sugar and nucleotide sugar metabolism
    DR_0823
Enzymes [BR:dra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     DR_0823
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:835370..836209
Genome map
AA seq 279 aa AA seqDB search
MTVILGIDIGGSGIKGAPVNTETGELVAERHRIPTPAGARPDDVKGVVAQLVEHFGLEGP
VGVTFPGIVQGGRILSAANVDSSWVDVDADELFTRTTGHEVYLINDADAAGLAEAKFGAG
KDVPGTVLVLTFGTGIGSALIRDGELVPNTELGHLWLKAKHAETWASDRARERDDLNWKQ
WAARASRYLQHLELLFSPDLFIIGGGVSRKADKWLPYLQLTRSRVVPAALQNEAGIVGAA
MLAASGPVRREQPAPAGETPNQPARTDAKKSDVSKARKK
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgacagtcattctgggcatcgacatcggcggcagcggcatcaagggggcgcccgtgaac
acggagacgggcgaactcgtcgccgagcggcaccgcattcccaccccggcgggagccagg
cccgacgacgtgaaaggcgtggtggcgcagctcgtcgagcatttcgggctggaagggccg
gtgggcgtgacctttcccggcatcgtgcagggcggcaggattctcagcgcggccaacgtg
gacagcagctgggtggacgtggacgccgacgagctgtttacccgcaccactgggcacgag
gtctacctcatcaacgacgccgacgccgccgggctcgccgaggccaagttcggggcgggc
aaggacgtaccgggcacggtgctcgtgctgaccttcggcaccggcatcggcagcgccctg
attcgtgacggagagctcgtgcccaacaccgaactcgggcacctgtggctcaaggccaag
cacgccgaaacctgggcctccgaccgcgcccgcgagcgcgacgacctgaactggaagcag
tgggcggcgcgtgccagccgttacctgcaacacctcgaactgctgttctcgcccgacctg
ttcatcatcggcgggggcgtgagccgcaaggccgacaagtggctgccgtatctccaactc
acccgcagccgcgtcgtgcctgccgccctgcaaaacgaagccggcatcgtcggcgccgcc
atgctcgccgcttcgggaccggtgcgccgcgagcagcccgcgcctgctggggaaacaccg
aatcagcctgctcgcacggacgcaaaaaaatcggacgtgagcaaggcccggaaaaaataa

DBGET integrated database retrieval system