KEGG   Deinococcus radiodurans: DR_0828Help
Entry
DR_0828           CDS       T00025                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
dra  Deinococcus radiodurans
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:dra00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DR_0828
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    DR_0828
Enzymes [BR:dra01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     DR_0828
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1:840142..841536
Genome map
AA seq 464 aa AA seqDB search
MPGKLSSLNEGRWPQRKTPPHGGRGGPDSHSRSDTMTPTPKTPAEILEKTWQTEERWQGI
KRNYTAEDVVRLRGSLPIEYTLAKHGANKLWQQMKEMPFVNALGALTGNQAMQQVKAGLK
AIYLSGWQVAGDANNAGQMYPDQSLYPASSVPDVVKRINNTLRRADQIQTSEGKNDIDYF
VPIVADAEAGFGGPLNAFELMKAMIEAGAAGVHFEDQLASEKKCGHLGGKVLVPTSQFIR
TLNAARLAADVSGVPTVLIARTDADAANLLTSDVDDNDKPFCTGERTPEGFFYVKPGIDQ
AISRALAYAPYADVIWCETSVPNLEDAKKFADAVHAQFPGKLLAYNCSPSFNWKKNLDDE
TIAKFQVELGKMGYKFQFITLAGFHALNMSMFDLAYGYARKQMSAFVELQEREFAAQERG
FTAVRHQREVGTGYFDLVSQAAGGGQSSTTALAGSTEAEQFAHH
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
gtgccaggcaaactgtcctcactgaacgaagggcgctggccacagcgaaagacacctccc
cacggtgggcgaggcggccctgactctcactcaaggagcgacaccatgacccccaccccc
aaaacccccgccgaaatcctggaaaagacctggcagaccgaagagcgctggcagggcatc
aagcgcaactacaccgccgaggacgtcgtccgcctgcgcggcagcctgcccatcgagtac
accctcgccaagcacggcgccaacaaactgtggcaacagatgaaggaaatgcccttcgtc
aacgcgctcggcgccctgaccggaaaccaggcgatgcagcaggtcaaggccggcctcaag
gccatctacctgtcgggctggcaggtcgccggtgacgccaacaacgcgggccagatgtac
cccgaccagagcctctaccccgccagcagcgtgccggacgtcgtcaagcgcatcaacaac
accctgcgccgcgccgaccagattcagaccagcgagggcaagaacgacatcgactacttc
gtgccgattgtcgccgacgccgaagcgggtttcggtggccccctcaacgcctttgaactc
atgaaggccatgatcgaagcgggcgccgccggcgtgcacttcgaagaccagctcgccagc
gagaagaagtgtggtcacctcggcggcaaggtgctcgtgcccaccagccagttcatccgc
accctgaacgcggcccgtctcgccgccgacgtgagcggcgtgcccaccgtcctgattgcc
cgcaccgacgccgacgccgccaacctgctgaccagcgacgtcgacgacaacgacaagccg
ttctgcaccggtgagcgcacccccgaaggcttcttctacgtcaagcccggcatcgaccag
gccatcagccgcgccctggcctacgctccttacgccgacgtgatctggtgcgaaaccagc
gtccccaacctggaagacgccaagaagttcgccgacgccgtgcacgcccagttccccggc
aagctgctcgcctacaactgctcgccctccttcaactggaagaagaacctggacgacgaa
accatcgccaagttccaggtcgaactcggcaagatgggctacaagttccagttcatcacc
ctggccggcttccacgcgctgaacatgagcatgttcgacctcgcctacggctacgcccgt
aagcagatgagcgccttcgtggaacttcaggagcgtgaattcgcggcccaggaacgcggc
ttcaccgccgtgcgccaccagcgcgaagtcggcaccggctacttcgacctcgtctcgcag
gcggcgggcggcggccagagcagcaccaccgcgctcgccggcagcaccgaagccgagcag
ttcgcgcaccactga

DBGET integrated database retrieval system