KEGG   Deinococcus radiodurans: DR_0941Help
Entry
DR_0941           CDS       T00025                                 

Definition
(RefSeq) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dra  Deinococcus radiodurans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dra00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DR_0941
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DR_0941
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DR_0941
Enzymes [BR:dra01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     DR_0941
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
1:956504..957799
Genome map
AA seq 431 aa AA seqDB search
MSTAKLGCPKLRIMPLSIPSFPLPDARGRYGRFGGRYVPETLIPALDELEQAYEAAKQDP
EFLDELDRLLREFVGRPNSLYLAERLTEHAGGAKIYLKREDQNFTGAHKINNCLAQALLA
KRMGKQKIIAETGAGQHGVASATAAALLGLSCVVYMGEEDMRRQSLNVFRMQLLGAEVRP
VTSGTATLKDATNEAIREWVTNVRDTFYILGSVVGPHPYPAMVRDFQSVIGEEVKVQLQE
KEGRSVPDAIVACVGGGSNAIGIFAPFAYLPEGERPRLIGTEAAGHGVDTGMHAASVAWG
RVGVLHGSMMYLMNDDEGQIVPPHSISAGLDYPGIGPEHCYYSVMGMAEYVPVTDAQALE
GLQLLTRLEGIIPALESAHAISYAVQLARQMKPEEIVVVNLSGRGDKDVTEVMRLLEQSE
NKQAEGQEVKA
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
ttgtcaactgcaaagctagggtgtcctaagctaagaatcatgcccctttccattcccagc
tttccgctgccagacgcccgtgggcggtatggccgctttggcgggcgctacgtgcccgaa
acgctgattccggcgctcgacgaactcgagcaggcgtatgaagcggccaagcaggacccc
gaatttctcgatgaactcgaccggctgctgcgcgaattcgtgggccggcccaacagcctg
tacctcgccgagcgcctgaccgaacacgcgggcggcgccaagatctacctcaagcgcgag
gaccagaactttaccggcgcgcacaagatcaacaactgtctggcccaggccttgctcgcc
aagcgcatgggcaagcagaaaatcatcgccgaaaccggcgccgggcagcacggtgtggcg
tcggccaccgcggcggcgctgctcgggctctcgtgcgtggtctacatgggcgaggaagac
atgcgccggcagtcgctcaacgtgttccgtatgcagctgctcggcgccgaggtccggcct
gtgacgagcggcaccgccaccctcaaggacgccaccaacgaggcgatccgcgagtgggtg
acgaacgtgcgcgacaccttttacatcctcggcagcgtggtggggccgcacccttacccg
gcgatggtgcgcgactttcagagcgtcatcggtgaggaggtcaaggtgcagctccaggaa
aaggaaggccgcagcgtgcccgacgccatcgtggcgtgtgtgggcggcggctccaacgcc
atcggcatcttcgcgcctttcgcttacctgccggagggcgagcgtccccgcttgatcggc
accgaggccgccgggcacggcgtggacaccgggatgcacgcggcgagcgtggcgtggggc
cgcgtcggggtgctgcacgggtcgatgatgtacctgatgaacgacgacgagggccagatc
gtgccgccgcactccatcagcgcggggctggactaccccggcatcggccccgagcactgc
tactactcggtgatgggcatggccgagtacgtgccggtcaccgacgcccaggcgcttgaa
gggctgcaactgctcacccgcctcgaaggcatcattcccgcgctggagtcggcgcacgcc
atctcctacgcggtgcagctcgcccggcagatgaagcccgaggaaatcgttgtggtcaac
ctctcggggcgcggcgacaaggacgtgaccgaggtgatgcgcctgcttgaacaatccgaa
aacaaacaggccgagggccaggaggtcaaggcatga

DBGET integrated database retrieval system