KEGG   Deinococcus radiodurans: DR_0942Help
Entry
DR_0942           CDS       T00025                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
dra  Deinococcus radiodurans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dra00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DR_0942 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DR_0942 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DR_0942 (trpA)
Enzymes [BR:dra01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     DR_0942 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
1:957796..958608
Genome map
AA seq 270 aa AA seqDB search
MTATPETATNRGVQRLHAAFARAEAEGRAAFIPFMTGGYPDAARFGEVAGDLLARADIME
VGIPYSDPLGDGPTIQRASEQALAGGTSTRRTLELVRELRQKDDTPIVIMTYINPIYAVG
PAEFMRLAQEAGVDGLILPDLPPDQDLEIADLAAQHGLAVTFLIAPTSTPERVKLVAEAC
TGFLYAVSVTGVTGAREGAALGEVPRMLDLARQYAQRPVVVGFGVKDAATAQQVAQVADG
VVVGSAFINAVAAGRDVGALADELAAGCRR
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgactccagaaacggccaccaatcgtggggttcagcgcctgcacgccgctttt
gcgcgcgctgaggcggaaggccgcgccgccttcattcccttcatgaccggcggctacccc
gacgcggcccgcttcggtgaggtggccggcgacctgctcgcgcgcgccgacatcatggaa
gtggggattccctactctgacccgctcggcgacggccccaccattcagcgggcctcggaa
caggcgctcgcgggcggcaccagcacccggcgcacgctggaactggtgcgtgagctgcgg
cagaaggacgacacccccatcgtcatcatgacctacatcaacccgatctacgccgtcggt
cccgccgagttcatgcggctggcgcaggaggcgggggtggacgggctgattctccccgat
ctgccgcccgaccaggacctcgaaattgccgacctcgccgcgcagcacgggctggccgtc
accttcctgatcgcgccgacctccacccccgagcgcgtgaaactggtcgccgaggcctgc
actggcttcctctacgccgtcagcgtgaccggcgtgaccggcgcccgtgaaggcgcggcg
ctcggcgaggtgccccggatgctcgacctcgcccggcagtacgcgcagaggccggtggtc
gtcggcttcggtgtgaaggacgcggccaccgctcagcaggtcgcgcaggtcgccgacggc
gtggtggtcggcagcgcctttatcaacgcggtggcagcgggacgggatgtaggtgccctt
gccgacgagcttgccgccgggtgccgccgctag

DBGET integrated database retrieval system