KEGG   Deinococcus radiodurans: DR_0953Help
Entry
DR_0953           CDS       T00025                                 

Definition
succinate dehydrogenase, hydrophobic subunit SdhD
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
dra  Deinococcus radiodurans
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:dra00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DR_0953
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DR_0953
   00650 Butanoate metabolism
    DR_0953
  Energy metabolism
   00190 Oxidative phosphorylation
    DR_0953
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(966866..967243)
Genome map
AA seq 125 aa AA seqDB search
MIKARTLSDARQQSHSNAELNWWIFMRISGLILVFLVLGHIYMTFIQVSEADATYVAVVN
KLSNPAWKFYDWLILALALLHGANGARYSIEDYVRTRPDRAWIKGTFYTVIALLFAFGTV
GLFSL
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgattaaggcccgcacactcagcgacgcccggcagcagtcgcactccaacgccgagctg
aactggtggattttcatgcgcatcagcggcctgattctggtcttcctggtgctgggacac
atctacatgacctttatccaggtcagcgaggccgacgccacctacgtcgcggtcgtcaac
aagctcagcaaccccgcctggaagttctacgactggctgattctggccctcgccctgctg
cacggggccaacggcgcgcgctactccatcgaggactacgtgcggacccggcctgaccgt
gcctggatcaagggcaccttctacaccgtgatcgccctgctgtttgctttcggcacagtg
ggtctcttttccctctga

DBGET integrated database retrieval system