KEGG   Deinococcus radiodurans: DR_1160Help
Entry
DR_1160           CDS       T00025                                 

Definition
uricase
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
dra  Deinococcus radiodurans
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:dra00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1:1170968..1171864
Genome map
AA seq 298 aa AA seqDB search
MMTGTQQPGTQPKVKVRLGENNYGKAEVQLMKIKRGTPRHELREAKVRVAMYGDFGAAHS
EGDNTDLVATDTVRNTVYGLAKEGFESSIEEFGKELLTHFVKVGPRVTGGFAEFTEHLWE
RVQTPAQPQGHDHAFVRQMPKRTARVETQDGRRFTVTSGIEELYVLKTTESGWENYLLDE
RFTTLPETHDRVMATFVTAKWEYAVESCDYDAVWERVYRQIQHTFTDHYSPSLQRTLYLM
GEAVLSVCPEISRIWFQMPNKHHLVYNLGRFGLENNNEILHVDPEPYGLMEAWVERAE
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgatgacgggaacccagcaaccgggcacgcagccgaaagtcaaagtgcggctcggcgag
aacaactatggcaaggccgaagtgcagctcatgaagatcaagcgcggcacgccccgccac
gagctacgcgaagccaaggtccgcgtcgccatgtatggcgatttcggtgctgcccactcc
gagggcgacaacaccgacctcgtcgccaccgataccgtccgcaacaccgtctatggactc
gccaaggaaggcttcgagagcagcatcgaggagttcggcaaagaacttctcacccacttc
gtgaaggtcggtccccgcgtcaccggggggttcgccgagttcaccgagcatctctgggaa
cgggtccagacccccgcgcagccccagggccatgaccacgccttcgtccggcagatgccc
aaacgcaccgcccgcgtcgaaacccaggatggtcggcgttttacggtgacttcgggcatc
gaagagctgtatgtcctcaagaccaccgagagcggctgggaaaactacctgctcgacgag
cgcttcaccacgctgcccgaaacccatgaccgggtgatggcgaccttcgtgacggcgaaa
tgggaatacgcggtggagagctgtgattacgacgcggtgtgggagcgggtgtacaggcag
attcagcacaccttcaccgatcactattccccaagtctgcaacggacgctgtacctgatg
ggagaagcggtgttgagtgtgtgcccggagatttcgcgcatctggtttcagatgccgaac
aagcaccatctggtgtacaacctggggcgcttcgggctggagaacaacaacgagattctg
cacgtggaccccgagccctacggcctgatggaagcctgggtggagcgcgccgagtga

DBGET integrated database retrieval system