KEGG   Deinococcus radiodurans: DR_1274Help
Entry
DR_1274           CDS       T00025                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
dra  Deinococcus radiodurans
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:dra03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1:complement(1280889..1281494)
Genome map
AA seq 201 aa AA seqDB search
MIAYLSGVVREVREGSAVVVAGGVGYEVQCPAGMLARLKPGEAAEFSTRFIVREDAQLLF
GFPDADHLKLFDLLTSVSGVGPKLGLALLSAMPVSALAAGLIGGDVKLLSSVSGVGKKTA
ERLALELSSKVPEHLAAAASGAAGGKRPARVSSTAGHDAVDALLALGFREAQVRAAVAEL
LGADPEASADTLIRKALGRLR
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgattgcttacttgtccggcgtggtgcgtgaagtgcgtgagggaagcgccgtggtcgtc
gcgggcggcgtgggctacgaggtgcagtgcccggcggggatgctggcccggctcaagccc
ggcgaggccgccgagttctccacccgcttcatcgtgcgcgaggacgcccaactgctgttc
ggctttcccgacgctgaccacctcaaactctttgacctgctcaccagtgtgtcgggtgtg
gggcccaagctggggctcgcgctgctctcggccatgccggtgtcggccctcgcggcaggg
ctcattggcggcgacgtgaaactgctctcgagcgtgagcggcgtgggcaaaaagaccgcc
gagcgcctcgcgctggagctgagcagcaaggtgcccgaacacctcgcggcggcggccagc
ggagcggcaggcggcaaacgcccggcgcgggtcagcagcacggcgggccacgacgcggtg
gacgcgctgctcgcgctcggcttccgcgaggcgcaggtgcgggcggcggtggccgaactg
ctcggcgccgaccccgaagcgagcgccgacaccctgattcgtaaggccctcgggcggctg
cggtga

DBGET integrated database retrieval system