KEGG   Deinococcus radiodurans: DR_1333Help
Entry
DR_1333           CDS       T00025                                 

Definition
glycosyl hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
dra  Deinococcus radiodurans
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:dra00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:dra00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Structure
PDB: 

Jmol
Position
1:complement(1336760..1337806)
Genome map
AA seq 348 aa AA seqDB search
MSPISEPSRLDPVRPGQLLMIDLPGPELDKDTAAYLREHGIGAVCLFGKNVESAEQLRRL
CADLREVMGEHALIAIDHEGGAITRPEFWPFAPSAMSLGAADDQQLTEDVNAALARQLRS
VGINWNFTPVLDINVNPANPVIGDRAYGSDAARVTRHGRAALAGHTREGVAPCAKHFPGH
GDTHQDSHLALPRVSKSRAELDAGELAPFRALLPETPAIMTAHIVYDALDAEHPATLSPR
ILTGLLREEWGYDGVIVTDSMGMQAIDANYGRGEAAVRALRAGADLVMALGRREVQQATL
AAVAEYVPENQAAVATKRERLRALARRFPAQADETLDPQADAALLADA
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtctcccatatctgaaccttcccggcttgaccccgtgcggcccggccaactgctgatg
atcgaccttcccggccccgaactcgacaaagacaccgctgcttatttgcgcgaacacggc
atcggcgcagtgtgcctgtttgggaaaaacgtggagagcgccgagcaactgcgacgcctc
tgcgcggacctgcgcgaggtgatgggtgagcacgcgctgatcgccatcgaccacgagggg
ggggcgattacccggcccgagttctggccgttcgcgccgagtgcgatgagcctgggggcg
gcggacgaccagcagctcaccgaggacgtgaacgcagcgctggcacggcaactgcgctcg
gtggggatcaactggaacttcacgccggtgctcgacatcaacgtgaatccagccaatccg
gtgatcggggaccgcgcttacggctcggacgcggcgcgggtcacgcggcatgggcgggcc
gcgctcgccggacacacgcgggagggggtggcgccctgcgccaagcattttcccggtcac
ggcgacacccaccaggacagtcacctcgccctgccacgcgtgagcaaaagccgcgccgag
ctggacgcgggcgaactcgcgcccttccgtgctctgctgcccgagacgcccgccatcatg
accgcgcacatcgtgtacgacgcgctcgacgccgagcatccggcgaccctttcgccgcgc
attctgaccgggctgctgcgcgaggagtggggctacgacggcgtcatcgtgaccgacagc
atgggaatgcaagcgatcgacgcgaactatggccggggcgaggcggcggtgcgggcgctg
cgggcgggggccgatctggtcatggcgctgggtcgccgcgaggtgcagcaggcgacgctg
gcagcggtggcggagtatgtgcccgagaatcaggcggcggtggcgaccaagcgggaacgg
ctgcgtgccctcgcccggcgctttccggcgcaggcggacgaaaccctcgacccgcaggcg
gacgctgcgctgctcgcagatgcctga

DBGET integrated database retrieval system