KEGG   Deinococcus radiodurans: DR_1333Help
Entry
DR_1333           CDS       T00025                                 

Definition
glycosyl hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
dra  Deinococcus radiodurans
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dra00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    DR_1333
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    DR_1333
Enzymes [BR:dra01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     DR_1333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Structure
PDB: 

Jmol
Position
1:complement(1336760..1337806)
Genome map
AA seq 348 aa AA seqDB search
MSPISEPSRLDPVRPGQLLMIDLPGPELDKDTAAYLREHGIGAVCLFGKNVESAEQLRRL
CADLREVMGEHALIAIDHEGGAITRPEFWPFAPSAMSLGAADDQQLTEDVNAALARQLRS
VGINWNFTPVLDINVNPANPVIGDRAYGSDAARVTRHGRAALAGHTREGVAPCAKHFPGH
GDTHQDSHLALPRVSKSRAELDAGELAPFRALLPETPAIMTAHIVYDALDAEHPATLSPR
ILTGLLREEWGYDGVIVTDSMGMQAIDANYGRGEAAVRALRAGADLVMALGRREVQQATL
AAVAEYVPENQAAVATKRERLRALARRFPAQADETLDPQADAALLADA
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtctcccatatctgaaccttcccggcttgaccccgtgcggcccggccaactgctgatg
atcgaccttcccggccccgaactcgacaaagacaccgctgcttatttgcgcgaacacggc
atcggcgcagtgtgcctgtttgggaaaaacgtggagagcgccgagcaactgcgacgcctc
tgcgcggacctgcgcgaggtgatgggtgagcacgcgctgatcgccatcgaccacgagggg
ggggcgattacccggcccgagttctggccgttcgcgccgagtgcgatgagcctgggggcg
gcggacgaccagcagctcaccgaggacgtgaacgcagcgctggcacggcaactgcgctcg
gtggggatcaactggaacttcacgccggtgctcgacatcaacgtgaatccagccaatccg
gtgatcggggaccgcgcttacggctcggacgcggcgcgggtcacgcggcatgggcgggcc
gcgctcgccggacacacgcgggagggggtggcgccctgcgccaagcattttcccggtcac
ggcgacacccaccaggacagtcacctcgccctgccacgcgtgagcaaaagccgcgccgag
ctggacgcgggcgaactcgcgcccttccgtgctctgctgcccgagacgcccgccatcatg
accgcgcacatcgtgtacgacgcgctcgacgccgagcatccggcgaccctttcgccgcgc
attctgaccgggctgctgcgcgaggagtggggctacgacggcgtcatcgtgaccgacagc
atgggaatgcaagcgatcgacgcgaactatggccggggcgaggcggcggtgcgggcgctg
cgggcgggggccgatctggtcatggcgctgggtcgccgcgaggtgcagcaggcgacgctg
gcagcggtggcggagtatgtgcccgagaatcaggcggcggtggcgaccaagcgggaacgg
ctgcgtgccctcgcccggcgctttccggcgcaggcggacgaaaccctcgacccgcaggcg
gacgctgcgctgctcgcagatgcctga

DBGET integrated database retrieval system