KEGG   Deinococcus radiodurans: DR_1339Help
Entry
DR_1339           CDS       T00025                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dra  Deinococcus radiodurans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dra00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DR_1339 (tpiA)
   01230 Biosynthesis of amino acids
    DR_1339 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DR_1339 (tpiA)
   00051 Fructose and mannose metabolism
    DR_1339 (tpiA)
   00562 Inositol phosphate metabolism
    DR_1339 (tpiA)
Enzymes [BR:dra01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     DR_1339 (tpiA)
Exosome [BR:dra04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   DR_1339 (tpiA)
  Exosomal proteins of bladder cancer cells
   DR_1339 (tpiA)
  Exosomal proteins of melanoma cells
   DR_1339 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1346447..1347181)
Genome map
AA seq 244 aa AA seqDB search
MQTLLALNWKMNKTPTEARSWAEELTTKYAPAEGVDLAVLAPALDLSALAANLPAGIAFG
GQDVSAHESGAYTGEISAAMLKDAGASCVVVGHSERREYHDESDABVAAKARQAQANGLL
PIVCVGENLDVRERGEHVPQTLAQLRGSLEGVGADVVVAYEPVWAIGTGKTATADDAEEL
AAAIRGALREQYGARAEGIRVLYGGSVKPENIAEICGKPNVNGALVGGASLKVPDVLGML
DALR
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccctcttggctctcaactggaaaatgaacaagacgcccaccgaagcgcggtcg
tgggcggaagaactgaccaccaagtacgcccccgccgagggtgtggacctcgccgtgctg
gccccggcgctggacctctcggcgctggcggccaacctcccggcaggcatcgccttcggc
gggcaggacgtttcggcccacgagtcgggcgcctacaccggcgaaatcagcgcggcgatg
ctgaaagacgcgggcgcaagctgcgtggtcgtcggtcactccgagcgccgcgagtaccac
gatgaaagcgacgcgratgtggccgccaaagcgcgtcaggcgcaggcaaacgggctgctg
ccgattgtttgcgtgggtgaaaacttggatgtgcgcgagcgcggcgagcacgtgccgcag
acgctggcgcaactgcgtggcagcctggaaggcgtgggcgccgacgtggtcgtggcttac
gagccagtctgggccatcggcaccggcaagacggccacagcggacgacgccgaggaactc
gctgccgccattcgtggggcgctacgcgagcaatacggtgcccgcgctgaaggcattcgc
gtgctgtacggcggcagcgtgaagccggagaatatcgccgagatttgcggtaagcccaac
gtgaacggcgcgctggtcggcggtgcgagcctcaaggtaccggatgtgctggggatgctg
gacgcgttgaggtga

DBGET integrated database retrieval system