KEGG   Deinococcus radiodurans: DR_1426Help
Entry
DR_1426           CDS       T00025                                 

Gene name
trpC
Definition
(RefSeq) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
dra  Deinococcus radiodurans
Pathway
dra00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dra01100  Metabolic pathways
dra01110  Biosynthesis of secondary metabolites
dra01130  Biosynthesis of antibiotics
dra01230  Biosynthesis of amino acids
Module
dra_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dra00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DR_1426 (trpC)
Enzymes [BR:dra01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     DR_1426 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-GeneID: 1797362
NCBI-ProteinID: NP_295149
UniProt: Q9RUG0
Position
1:1427460..1428263
Genome map
AA seq 267 aa AA seqDB search
MTFSPPDLSRVPGVLGRIVTEREADYRNADASLGEARAPHRRFEQALRLSPDDRGARLAL
IAEVKQASPSEGAIAALDPAQAARAYAEGGAAAISCLTEPRHFGGSPEALRAVVAASEVP
VLRKDFVVHPAMLREAAEWGAGAALLMVSVLGERLPEFLAMTEHLGLDALVEVHDERELD
IALAAGPRILGINNRDLTTLKIDLGVSPHLMARARAAGFSGVLVAESGYRAPADLREVYG
LADAVLVGTSLAGSGDLAGAARALLAR
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgacgttttctcctcctgacctcagccgggtgcccggcgtccttggccgcatcgtgacg
gagcgggaggcggattaccgcaatgccgacgcaagtctgggcgaggccagagcgccccac
cgccgtttcgagcaggcgttgcggctktcgcccgacgaccggggcgcacgcctggcgctg
attgccgaagtcaagcaggcgagtccgagcgagggcgcgattgcggcgctcgacccggca
caggcggcgcgggcctacgccgagggcggcgcggcggccatcagttgcctgaccgagccg
cgtcacttcggcggcagcccggaggcgctgcgggcggtggtcgccgcgagtgaggtgccg
gtgctgcgcaaggatttcgtcgttcaccccgccatgctgcgcgaggccgccgagtggggc
gcgggcgcggcgctcctgatggtcagcgtcttgggcgagcggctgcccgagtttctggcg
atgaccgagcacctcggtctcgatgccctggtcgaagtccacgacgaacgcgaactcgat
atcgctcttgccgccgggccgcgcatcctgggcatcaacaaccgcgacctgaccaccctc
aagattgacctcggcgtcagtccccatctcatggcgcgtgcccgcgcggctggcttcagc
ggggtgctggtggcggaaagcggctaccgcgctcctgccgacctgcgtgaggtctacggc
cttgccgacgccgtgctggtgggcacttcgctcgccggcagtggggacctcgccggggcg
gcgcgggcgctgctggcccgctga

DBGET integrated database retrieval system