KEGG   Deinococcus radiodurans: DR_1508Help
Entry
DR_1508           CDS       T00025                                 

Definition
(RefSeq) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
dra  Deinococcus radiodurans
Pathway
dra00900  Terpenoid backbone biosynthesis
dra01100  Metabolic pathways
dra01110  Biosynthesis of secondary metabolites
dra01130  Biosynthesis of antibiotics
Module
dra_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:dra00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DR_1508
Enzymes [BR:dra01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     DR_1508
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_redisom_C DXP_reductoisom
Motif
Other DBs
NCBI-GeneID: 1798665
NCBI-ProteinID: NP_295231
UniProt: Q9RU84
Position
1:complement(1523685..1524875)
Genome map
AA seq 396 aa AA seqDB search
MSGVRLTVLGSTGSIGTQTLDVARQRGYTVGTLAAGRNLDLLAEQVREFRPALVSVDGSI
LAEARERLSGVRVIADPSEAAVAQADVVVNAMSGLIGLPPTRAALEAGQAVALATKEAMV
TSAHLMWEAAAAGGGRVVPVDSEHTGVYQCLTGEDMGDVAELILTASGGPFRDGPADLSA
VTPEQALKHPSWSMGPKVTIDSATLMNKGLEVMECASLYGLPLSQVGVVVHPQSIVHAAV
RLRDGSLKAQFGPADMRLPIAYAIDAAPSGMQHPGDVRGARRGEEVGEHLGWPLLGQWEF
RAPDLTRFPCLALAYRAGEAGGLLPVALNAADEVAVDAFLHGRIGFLDIPQLIERVLDET
PGGALTWDSLTETDAWARARAQELCAYGVGGAGVGA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggcgtgagactcaccgttctgggcagtacaggcagcatcggcacgcaaacactg
gacgtggcgcggcagcgcgggtatacggtgggcacgctcgccgccggacgcaatctggac
ttgctcgccgagcaggtgcgcgagttccggcccgccctggtcagcgtggacgggtccatt
ctggccgaggcgagagaacggctgagcggagtgcgcgtgattgccgacccctccgaagca
gcggtggcacaggccgatgtggttgtcaacgccatgagcggcctgattggtttgcccccc
acccgcgccgcactcgaagccgggcaggcggtggcactggcgacgaaggaagcgatggtc
acgtcggcccacttgatgtgggaagcggcggcagcgggtgggggccgggtggtgccggta
gattccgagcacaccggggtctaccagtgcctgaccggcgaggatatgggggacgtggcc
gagttgattctcacggcatcgggcgggccgtttcgggatggccccgccgacctgagcgcg
gtcacgcctgagcaggcgctgaagcatccgtcgtggagcatggggcccaaagtgaccatc
gactcggccaccctgatgaacaagggcctggaagtcatggagtgtgccagcctctacggc
ctgccgctctcgcaggtgggcgtggtcgttcatccgcagagcatcgttcacgcggcggtg
cgattgcgcgacggcagcctgaaagcgcagttcggcccagcggacatgcgcctgccgatt
gcctacgccatcgacgccgcgccgagcgggatgcaacaccccggcgacgtgcgcggggcg
cggcgtggggaagaggtcggggagcatctcggctggccgctgctggggcagtgggaattc
cgggcaccggacctgacgcgctttccctgcctcgcgctcgcttaccgggcgggtgaggcg
ggcggactcctgccagtggcgctcaacgcggcggacgaggtggcggtggacgctttcctg
cacgggcgcatcggctttctggacattccccagctgattgaaagggtgctggacgagacg
cccggcggcgccctcacctgggacagcctgacggagacggacgcctgggcacgcgccaga
gcgcaggaactctgtgcctacggggtcggcggcgccggggtgggcgcgtga

DBGET integrated database retrieval system