KEGG   Deinococcus radiodurans: DR_1525Help
Entry
DR_1525           CDS       T00025                                 

Definition
carbohydrate kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
dra  Deinococcus radiodurans
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:dra00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    DR_1525
Enzymes [BR:dra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     DR_1525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1541238..1542173)
Genome map
AA seq 311 aa AA seqDB search
MKFYVIGDVTVDHLYHLDRLPAPGKEVTPKRSTMQPGGSGGTISVTLARLGHTVTLAARV
GDDPFAEFALAEIKASGVSLSAIQKDPEHLTSTITVMQTSGGQRAMISDGAANRQLDPAK
LKKKDVESADALIISAYSLTEGPQREYAQKAIEIARGAKKPVPVFIDLGTGAVEKVGTGL
VAEVRGADYLTLNQHELLALTGTRSLSAGLARLAEAGVERVAVKVGKMGSVVWTPEDTEL
VDAVLPEGTVVDTTGAGDTFTAAFAHAVLSGLPLTQAARVANAAGALAATAVGAQSKPIL
VGDLERVAQSK
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
gtgaagttttacgtcatcggcgacgtgactgttgaccatctgtaccacctcgaccgcctg
cctgcccctggcaaggaagtcacccccaaacgctccaccatgcagccgggcggctcgggc
ggcaccatcagcgtgacgctggcgcgcctcgggcacactgttaccctggcggcccgcgtg
ggcgacgacccctttgccgagttcgcgctggccgaaatcaaggcgagcggcgtgagcctg
agcgccattcagaaagaccccgagcacctcacgagcaccatcacggtcatgcagacctcg
ggcgggcagcgcgccatgatcagcgacggggccgccaaccggcagctcgaccccgccaag
ctgaagaaaaaagacgtggaaagcgccgacgccctcatcatcagcgcctacagcctgacc
gaggggccgcagcgcgagtacgcgcaaaaggcgattgagattgcccgcggggcgaaaaag
cccgtgcctgtctttatcgacctcggcaccggcgcggtggaaaaggtcggcactggtctg
gtggctgaggtgcgcggcgccgactacctcaccctcaaccagcacgagctgctcgccctg
accggcacccgcagcctcagtgcgggcctggcgcgcctcgccgaagcgggcgtggagcgc
gtggccgtcaaggtgggcaagatgggcagcgtggtctggacccccgaagacaccgaactg
gtggacgccgtgctgcccgaaggcaccgtggtggacaccaccggcgcgggcgacactttt
actgccgcctttgcccacgcggtcctcagtggcctgccgctcacgcaggcggcgcgggtc
gccaacgcggctggggcactggccgccactgccgtgggcgcacagagcaagccgattctg
gtcggggacctcgagcgggtggcgcaaagcaagtag

DBGET integrated database retrieval system