KEGG   Deinococcus radiodurans: DR_1589Help
Entry
DR_1589           CDS       T00025                                 

Definition
fructose-bisphosphate aldolase
Orthology
K01624  
fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
dra  Deinococcus radiodurans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:dra01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:dra01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dra00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:dra00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:dra00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:dra00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1:1608800..1609717
Genome map
AA seq 305 aa AA seqDB search
MLVTGKDILVPARAGKYAVGAFNTNNMEITQAIIHTAEKLRSPVIVQMSEGAIKYGGQDL
ANIVIDLATRATVPVALHLDHGSSYESALNAIKMGFTSVMIDASHHPFEENVHETKRVVE
AAHAMGISVEAELGRLGGIEEHVVVDEKDAFLTDPDEAVKFVEETGTDYLAIAIGTSHGA
YKGKGRPFIDQARIKKIGELLSIPLVAHGSSGVPAEIVQRLRAAGGEIGDAAGIADEDLT
EAAQYGIAKVNVDTDLRLASTVGIREVLKATPKEFDPRKIFGPARDVMSQIVEHKMGVLG
SVGKA
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgctcgttaccggtaaagacattctggttcccgcccgcgcaggcaaatacgcggtcggt
gcgttcaacaccaacaacatggaaatcacccaggccatcatccacacggcggaaaaactg
cgctcgcccgtcatcgtgcagatgagtgaaggggccatcaagtatggcggccaggacctc
gccaacatcgtgatcgacctcgcgacccgcgccaccgtgcccgtcgcgctgcacctcgac
cacggctcctcctacgagtcggcactcaacgccatcaagatgggctttacctcggtgatg
atcgacgcctcgcaccaccccttcgaggagaacgtccacgaaaccaagcgcgtggtcgaa
gccgcgcacgccatgggcatcagcgtggaagccgaactcgggcgcctcggcggcatcgag
gagcacgtcgtcgtggacgagaaggacgccttcctgaccgaccccgacgaagccgtcaag
ttcgtcgaggagaccggcaccgattacctcgccatcgccatcggcaccagccacggcgcg
tacaagggtaagggccgcccgtttatcgaccaggcgcgcatcaagaagatcggcgagctg
ctcagcattccgctcgtcgcgcacggctccagcggcgttccggcggaaatcgtgcagcgt
ctgcgcgcagcgggcggtgaaatcggcgacgcagcgggcattgccgacgaggacctgacc
gaagccgcgcagtacggcatcgccaaggtgaacgtggacaccgacctgcgcctcgccagc
accgtgggcattcgcgaagtcctcaaggccacccccaaggaattcgacccccgcaagatt
ttcggcccggcccgcgacgtgatgagccagattgtcgagcacaagatgggcgtgctcggc
agcgtcggcaaagcctaa

DBGET integrated database retrieval system