KEGG   Deinococcus radiodurans: DR_1589Help
Entry
DR_1589           CDS       T00025                                 

Definition
fructose-bisphosphate aldolase
Orthology
K01624  
fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
dra  Deinococcus radiodurans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dra00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DR_1589
   01230 Biosynthesis of amino acids
    DR_1589
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DR_1589
   00030 Pentose phosphate pathway
    DR_1589
   00051 Fructose and mannose metabolism
    DR_1589
  Energy metabolism
   00680 Methane metabolism
    DR_1589
Enzymes [BR:dra01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     DR_1589
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1:1608800..1609717
Genome map
AA seq 305 aa AA seqDB search
MLVTGKDILVPARAGKYAVGAFNTNNMEITQAIIHTAEKLRSPVIVQMSEGAIKYGGQDL
ANIVIDLATRATVPVALHLDHGSSYESALNAIKMGFTSVMIDASHHPFEENVHETKRVVE
AAHAMGISVEAELGRLGGIEEHVVVDEKDAFLTDPDEAVKFVEETGTDYLAIAIGTSHGA
YKGKGRPFIDQARIKKIGELLSIPLVAHGSSGVPAEIVQRLRAAGGEIGDAAGIADEDLT
EAAQYGIAKVNVDTDLRLASTVGIREVLKATPKEFDPRKIFGPARDVMSQIVEHKMGVLG
SVGKA
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgctcgttaccggtaaagacattctggttcccgcccgcgcaggcaaatacgcggtcggt
gcgttcaacaccaacaacatggaaatcacccaggccatcatccacacggcggaaaaactg
cgctcgcccgtcatcgtgcagatgagtgaaggggccatcaagtatggcggccaggacctc
gccaacatcgtgatcgacctcgcgacccgcgccaccgtgcccgtcgcgctgcacctcgac
cacggctcctcctacgagtcggcactcaacgccatcaagatgggctttacctcggtgatg
atcgacgcctcgcaccaccccttcgaggagaacgtccacgaaaccaagcgcgtggtcgaa
gccgcgcacgccatgggcatcagcgtggaagccgaactcgggcgcctcggcggcatcgag
gagcacgtcgtcgtggacgagaaggacgccttcctgaccgaccccgacgaagccgtcaag
ttcgtcgaggagaccggcaccgattacctcgccatcgccatcggcaccagccacggcgcg
tacaagggtaagggccgcccgtttatcgaccaggcgcgcatcaagaagatcggcgagctg
ctcagcattccgctcgtcgcgcacggctccagcggcgttccggcggaaatcgtgcagcgt
ctgcgcgcagcgggcggtgaaatcggcgacgcagcgggcattgccgacgaggacctgacc
gaagccgcgcagtacggcatcgccaaggtgaacgtggacaccgacctgcgcctcgccagc
accgtgggcattcgcgaagtcctcaaggccacccccaaggaattcgacccccgcaagatt
ttcggcccggcccgcgacgtgatgagccagattgtcgagcacaagatgggcgtgctcggc
agcgtcggcaaagcctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system