KEGG   Deinococcus radiodurans: DR_1848Help
Entry
DR_1848           CDS       T00025                                 

Definition
(RefSeq) glycogen branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
dra  Deinococcus radiodurans
Pathway
dra00500  Starch and sucrose metabolism
dra01100  Metabolic pathways
dra01110  Biosynthesis of secondary metabolites
Module
dra_M00565  Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:dra00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DR_1848
Enzymes [BR:dra01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     DR_1848
Exosome [BR:dra04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DR_1848
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase AMPK1_CBM
Motif
Other DBs
NCBI-GeneID: 1798355
NCBI-ProteinID: NP_295571
UniProt: Q9RTB7
Position
1:complement(1871568..1873685)
Genome map
AA seq 705 aa AA seqDB search
MTFPLPLDHEHLQKLVTADLVRPDHLLGAHPTTEHGVQGVRFAVWAPNAQHVSVVGDFND
WNGFDHPLQRLDFGFWGAFVPAAQPGQRYKFRVTGAGGQTVDKTDPYGTFFEVRPNNASI
IWQQDFEWTDAGWLEQRARRGQALEDPISIYECHVGSWARRDDGWFLNYRDLAHRLGEYV
TYMGYTHVELLGVMEHPFDGSWGYQVTGYYAPTSRLGSPEDFKYLVNHLHSLGIGVLLDW
VPGHFPTDEFALAHFDGSPLYEYADPRKGYHYDWNTYIFDYGRNEVVMFLIGSALKWVQD
YHVDGLRVDAVASMLYLDFSRTEWVPNIYGGRENLEAIAFLKRLNEVAHHMAPGCLMIAE
ESTSFPGVTTPTPEGLGFDYKWAMGWMNDSLAYFEQDPIYRKYDHHKLTFFNVYRTSENY
VLAISHDEVVHLKKPMVLKHPGDWYAQRADYRAFLAMMWTTPGKKLLFMGQDFAQGSEWN
HDAPLPWFHADQPDHRGVMNLVRRLNELYRERPDWHTGDAREEGMAWISADDTDNSVYAY
ARRDTYSGAWSLVIANLTPVYREDYVIGVPQGGEYRVLLSTDDGEFGGFGTQQPDLSARD
EAAHGQAHALHLNLPPSSVLVLEPVAAAPVKGLVSRQELTPELREVARQSAQAVQVERAA
DPRPNEQQRLVAETPAHEGGRSAPADAAESAEQKPDDEQKGGKKA
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgacgtttcccttgcccctcgaccacgagcacctgcaaaagctggtgaccgccgatctg
gtccggcccgaccacctgctcggcgcccacccgaccaccgaacacggggttcagggggtg
cgcttcgccgtgtgggcaccgaacgcgcagcatgtgagtgtcgtgggcgatttcaacgac
tggaacggcttcgaccatcccttgcagcgcctcgacttcgggttctggggcgccttcgtg
cccgccgcgcagccgggccagcgctacaaattccgcgtgaccggcgccggggggcagacc
gtggacaagaccgacccctacggcacctttttcgaggtgcggcccaacaacgcgagcatc
atctggcagcaggacttcgaatggaccgacgccgggtggctggagcagcgggcgcggcga
gggcaggcgctcgaagaccccatcagcatctacgagtgccatgtcggctcgtgggcgcgg
cgtgacgacggctggttcctgaactaccgcgacctcgcgcaccggctgggcgagtacgtg
acctacatgggctacacccacgtcgaactgctcggcgtgatggagcaccccttcgacggc
tcgtggggctatcaggtcacgggctactacgccccgaccagccgcctgggcagcccggaa
gatttcaaatatctggtcaaccatttgcactcgctcggcatcggcgtgttgctcgactgg
gtgccgggccatttccccaccgacgagttcgcgctcgcgcacttcgacggttcgccgctc
tacgagtacgccgacccgcgcaagggctaccactacgactggaacacctacatcttcgac
tatggccgcaacgaggtcgtgatgttcctgatcggctcggccctgaagtgggtgcaggac
taccacgtggacggcctgcgggtggacgcggtggcctccatgctgtacctggacttttcg
cgcaccgagtgggtgccgaacatctatggcgggcgcgagaacctcgaggccatcgccttt
ctcaagcgcctgaacgaggtcgcgcaccacatggcccccggctgcctgatgattgccgag
gaaagcacgtctttccctggcgtcaccacgccgacgcccgagggcttgggcttcgactac
aagtgggcgatgggctggatgaacgactcgctcgcctacttcgagcaggacccgatctac
cgcaagtacgaccaccacaagctgacttttttcaacgtgtaccggacgagtgaaaactac
gtgctggcgattagccacgacgaggtggtgcacctcaaaaagccgatggtcctcaagcac
cccggcgactggtacgcgcagcgcgccgactaccgcgcttttctcgccatgatgtggacc
acgcccggcaagaagctgctgttcatgggccaggactttgcccagggcagcgagtggaac
catgacgcgccgctgccgtggttccacgccgaccagcccgaccaccgtggcgtcatgaat
ctggtgcggcgcctgaacgagctttaccgcgagcgccccgactggcacacgggggacgcc
cgcgaggaaggcatggcgtggatcagtgccgacgacaccgacaactcggtctacgcctac
gcccggcgcgacacctacagcggggcctggagtctggtgatcgccaacctaactccggtc
taccgcgaggactacgtgatcggcgtgccccagggcggcgagtaccgcgtgctgctgtcc
accgacgacggcgaatttggcggcttcggcacccagcaacccgacctcagcgcccgcgac
gaagccgcccacggtcaggcccacgccctgcacctgaacctgccgccgagcagcgtgctg
gtgcttgaacccgtggccgccgcgccggtgaagggccttgtcagccgccaggaactgacc
cccgaactgcgcgaagtcgcccggcaatcggcccaggcggtgcaggtcgagcgcgccgcc
gacccccgccccaacgagcaacagcggctggtggccgagacgccggcccatgaggggggc
cgcagcgctccggcagacgccgctgaatcggcagagcagaagcctgacgacgagcagaaa
ggcgggaagaaggcttga

DBGET integrated database retrieval system