KEGG   Deinococcus radiodurans: DR_1902Help
Entry
DR_1902           CDS       T00025                                 

Definition
exodeoxyribonuclease V subunit RecD
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
dra  Deinococcus radiodurans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dra00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    DR_1902
Enzymes [BR:dra01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     DR_1902
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1:complement(1919913..1922060)
Genome map
AA seq 715 aa AA seqDB search
MSAALPAEPFRVSGGVNKVRFRSDTGFTVMSATLRNEQGEDPDATVIGVMPPLDVGDTFS
AEVLMEEHREYGYQYRVVNMVLEAMPADLSEEGVAAYFEARVGGVGKVLAGRIAKTFGAA
AFDLLEDDPQKFLQVPGITESTLHKMVSSWSQQGLERRLLAGLQGLGLTINQAQRAVKHF
GADALDRLEKDLFTLTEVEGIGFLTADKLWQARGGALDDPRRLTAAAVYALQLAGTQAGH
SFLPRSRAEKGVVHYTRVTPGQARLAVETAVELGRLSEDDSPLFAAEAAATGEGRIYLPH
VLRAEKKLASLIRTLLATPPADGAGNDDWAVPKKARKGLSEEQASVLDQLAGHRLVVLTG
GPGTGKSTTTKAVADLAESLGLEVGLCAPTGKAARRLGEVTGRTASTVHRLLGYGPQGFR
HNHLEPAPYDLLIVDEVSMMGDALMLSLLAAVPPGARVLLVGDTDQLPPVDAGLPLLALA
QAAPTIKLTQVYRQAAKNPIIQAAHGLLHGEAPAWGDKRLNLTEIEPDGGARRVALMVRE
LGGPGAVQVLTPMRKGPLGMDHLNYHLQALFNPGEGGVRIAEGEARPGDTVVQTKNDYNN
EIFNGTLGMVLKAEGARLTVDFDGNVVELTGAELFNLQLGYALTVHRAQGSEWGTVLGVL
HEAHMPMLSRNLVYTALTRARDRFFSAGSASAWQIAAARQREARNTALLERIRAH
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctgccctgcctgccgagccgtttcgagtctccgggggggtcaacaaagtccgt
ttccgctccgacaccggctttaccgtcatgagtgccacgctgcgcaacgagcagggcgag
gaccccgacgccaccgtgattggcgtcatgccgccgctcgacgtgggcgacaccttcagc
gccgaggtgctgatggaagagcaccgcgagtacggctaccagtaccgggtggtcaacatg
gtgctggaagccatgcccgccgacctgtccgaggagggcgtggcggcttacttcgaggcg
cgggtgggcggcgtgggcaaagtgctggcggggcgcatcgccaagaccttcggcgcggcg
gccttcgacctgctcgaagacgacccacagaagttcttgcaggtgcccggtatcaccgag
tccaccctgcacaagatggtgagcagttggagccagcaggggctggagcggcggctgctc
gcgggcttgcagggcctcgggctgaccatcaatcaggcgcagcgggcggtcaaacatttc
ggggccgacgcgctcgaccggctggaaaaagacctctttacgctgaccgaagtcgagggc
atcggctttctgaccgccgacaagctctggcaggcccgcggcggcgcgctcgacgacccc
cgccgcctgaccgccgccgccgtgtacgcgctgcaactcgccgggacgcaggccgggcac
agcttcctgccgcgctcgcgggccgaaaaaggcgtggtccactacacccgcgtcacgccg
gggcaggcgcgactggcggtggaaacggcggtggaactcgggcggctctcggaagacgat
tcgccgctctttgccgcagaagccgccgctaccggcgagggccgcatttacctgccccac
gtcctgcgcgccgagaaaaagctggcgagcctgattcgcacgctgctcgccaccccgcct
gccgacggcgcgggcaacgacgactgggccgttccgaaaaaggctcgcaagggcctctcg
gaagagcaggcgagcgtgctggaccagctcgcggggcaccggctggtcgtcctgaccggc
ggccccggcaccggcaaaagcacgacgacgaaggcggtcgctgacctcgccgagtcgctg
gggctggaagtcggcctctgcgccccgaccggcaaggcggcgcggcggctgggtgaggtg
acgggccgcaccgccagtaccgttcaccggctgctcggctacgggccgcagggcttccgg
cacaaccacctcgaacccgcgccgtatgacctcctgatcgtggacgaggtgagcatgatg
ggcgacgcgctgatgctctcgctgctcgccgccgtgccgccgggggcgcgggtgctgctc
gtgggcgacaccgaccagttgccgccagtggacgccgggctgccgctgctcgcgctcgcg
caggcggcccccaccatcaagctcacgcaggtctaccgtcaggcggccaagaaccccatt
attcaggcggcgcatggcctgctgcacggcgaggccccggcgtggggcgacaaacggctc
aatctcaccgaaatcgagcctgacggcggcgcccggcgcgtggcgctgatggtgcgcgaa
ctcggcggccccggcgcggtgcaggtgctcacgccgatgcgtaaagggccgctgggcatg
gaccacctcaattaccacttgcaggcgctgttcaaccccggcgagggcggcgtgcggata
gccgagggcgaggcgcggcccggcgacacggtggtgcagaccaaaaacgactacaacaac
gagattttcaacggcacgctcggcatggtcctcaaggccgagggcgcgcggctgacggtg
gatttcgacggcaacgtggtggaactgaccggcgccgaactgttcaacctgcaactcggc
tacgcgctgaccgttcaccgcgcccagggcagcgaatggggcacggtgctcggcgtgctg
cacgaggcgcacatgccgatgctctcgcgcaatctggtgtacacggcgctcacccgcgcc
agagaccgctttttttcagccgggtcggcctcggcatggcagattgcggcggcccggcag
cgtgaagcgcggaatacggcgctgttggaaagaatcagggcgcattaa

DBGET integrated database retrieval system