KEGG   Deinococcus radiodurans: DR_1902Help
Entry
DR_1902           CDS       T00025                                 

Definition
exodeoxyribonuclease V subunit RecD
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
dra  Deinococcus radiodurans
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:dra03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Structure
PDB: 

Jmol
Position
1:complement(1919913..1922060)
Genome map
AA seq 715 aa AA seqDB search
MSAALPAEPFRVSGGVNKVRFRSDTGFTVMSATLRNEQGEDPDATVIGVMPPLDVGDTFS
AEVLMEEHREYGYQYRVVNMVLEAMPADLSEEGVAAYFEARVGGVGKVLAGRIAKTFGAA
AFDLLEDDPQKFLQVPGITESTLHKMVSSWSQQGLERRLLAGLQGLGLTINQAQRAVKHF
GADALDRLEKDLFTLTEVEGIGFLTADKLWQARGGALDDPRRLTAAAVYALQLAGTQAGH
SFLPRSRAEKGVVHYTRVTPGQARLAVETAVELGRLSEDDSPLFAAEAAATGEGRIYLPH
VLRAEKKLASLIRTLLATPPADGAGNDDWAVPKKARKGLSEEQASVLDQLAGHRLVVLTG
GPGTGKSTTTKAVADLAESLGLEVGLCAPTGKAARRLGEVTGRTASTVHRLLGYGPQGFR
HNHLEPAPYDLLIVDEVSMMGDALMLSLLAAVPPGARVLLVGDTDQLPPVDAGLPLLALA
QAAPTIKLTQVYRQAAKNPIIQAAHGLLHGEAPAWGDKRLNLTEIEPDGGARRVALMVRE
LGGPGAVQVLTPMRKGPLGMDHLNYHLQALFNPGEGGVRIAEGEARPGDTVVQTKNDYNN
EIFNGTLGMVLKAEGARLTVDFDGNVVELTGAELFNLQLGYALTVHRAQGSEWGTVLGVL
HEAHMPMLSRNLVYTALTRARDRFFSAGSASAWQIAAARQREARNTALLERIRAH
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctgccctgcctgccgagccgtttcgagtctccgggggggtcaacaaagtccgt
ttccgctccgacaccggctttaccgtcatgagtgccacgctgcgcaacgagcagggcgag
gaccccgacgccaccgtgattggcgtcatgccgccgctcgacgtgggcgacaccttcagc
gccgaggtgctgatggaagagcaccgcgagtacggctaccagtaccgggtggtcaacatg
gtgctggaagccatgcccgccgacctgtccgaggagggcgtggcggcttacttcgaggcg
cgggtgggcggcgtgggcaaagtgctggcggggcgcatcgccaagaccttcggcgcggcg
gccttcgacctgctcgaagacgacccacagaagttcttgcaggtgcccggtatcaccgag
tccaccctgcacaagatggtgagcagttggagccagcaggggctggagcggcggctgctc
gcgggcttgcagggcctcgggctgaccatcaatcaggcgcagcgggcggtcaaacatttc
ggggccgacgcgctcgaccggctggaaaaagacctctttacgctgaccgaagtcgagggc
atcggctttctgaccgccgacaagctctggcaggcccgcggcggcgcgctcgacgacccc
cgccgcctgaccgccgccgccgtgtacgcgctgcaactcgccgggacgcaggccgggcac
agcttcctgccgcgctcgcgggccgaaaaaggcgtggtccactacacccgcgtcacgccg
gggcaggcgcgactggcggtggaaacggcggtggaactcgggcggctctcggaagacgat
tcgccgctctttgccgcagaagccgccgctaccggcgagggccgcatttacctgccccac
gtcctgcgcgccgagaaaaagctggcgagcctgattcgcacgctgctcgccaccccgcct
gccgacggcgcgggcaacgacgactgggccgttccgaaaaaggctcgcaagggcctctcg
gaagagcaggcgagcgtgctggaccagctcgcggggcaccggctggtcgtcctgaccggc
ggccccggcaccggcaaaagcacgacgacgaaggcggtcgctgacctcgccgagtcgctg
gggctggaagtcggcctctgcgccccgaccggcaaggcggcgcggcggctgggtgaggtg
acgggccgcaccgccagtaccgttcaccggctgctcggctacgggccgcagggcttccgg
cacaaccacctcgaacccgcgccgtatgacctcctgatcgtggacgaggtgagcatgatg
ggcgacgcgctgatgctctcgctgctcgccgccgtgccgccgggggcgcgggtgctgctc
gtgggcgacaccgaccagttgccgccagtggacgccgggctgccgctgctcgcgctcgcg
caggcggcccccaccatcaagctcacgcaggtctaccgtcaggcggccaagaaccccatt
attcaggcggcgcatggcctgctgcacggcgaggccccggcgtggggcgacaaacggctc
aatctcaccgaaatcgagcctgacggcggcgcccggcgcgtggcgctgatggtgcgcgaa
ctcggcggccccggcgcggtgcaggtgctcacgccgatgcgtaaagggccgctgggcatg
gaccacctcaattaccacttgcaggcgctgttcaaccccggcgagggcggcgtgcggata
gccgagggcgaggcgcggcccggcgacacggtggtgcagaccaaaaacgactacaacaac
gagattttcaacggcacgctcggcatggtcctcaaggccgagggcgcgcggctgacggtg
gatttcgacggcaacgtggtggaactgaccggcgccgaactgttcaacctgcaactcggc
tacgcgctgaccgttcaccgcgcccagggcagcgaatggggcacggtgctcggcgtgctg
cacgaggcgcacatgccgatgctctcgcgcaatctggtgtacacggcgctcacccgcgcc
agagaccgctttttttcagccgggtcggcctcggcatggcagattgcggcggcccggcag
cgtgaagcgcggaatacggcgctgttggaaagaatcagggcgcattaa

DBGET integrated database retrieval system