KEGG   Deinococcus radiodurans: DR_1980Help
Entry
DR_1980           CDS       T00025                                 

Definition
hypothetical protein
Orthology
K00329  
NADH dehydrogenase [EC:1.6.5.3]
K00356  
NADH dehydrogenase [EC:1.6.99.3]
Organism
dra  Deinococcus radiodurans
Pathway
Oxidative phosphorylation
Brite
KEGG Orthology (KO) [BR:dra00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    DR_1980
Enzymes [BR:dra01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     DR_1980
   1.6.99  With other acceptors
    1.6.99.3  NADH dehydrogenase
     DR_1980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1:2002633..2003598
Genome map
AA seq 321 aa AA seqDB search
MRGMAEQAEHPSRILVTGASGFVGRATLAELTRRGYEVVAGSRQGKGVGRGIGIKLDVTS
EKSVRQALQDVQPAAVIHLVGIIAEKGKQTFERVHIEGTRHVLDALRDYDAARQQAHKGD
EMERPHPTRYLHMSALGADVLSPSAYSWSKGEAEGLVRLSGLPWTIFRPSLIFGVGDDFF
GRVLKNLVSAAPVVPQIGDGQFPFRPISVEDVALAFAEALVKPETVGQIYALTGPQEFTF
KELLALEQQALGQQKKVVPVPQKLMDLAVPVISRLPAAPITRDQYAMLKAGNTAPNDAAR
AAFNLPLHRLQDRLPYIVDRK
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgcggggtatggctgagcaagcagaacatccctcccgcatcctcgtgaccggcgcgagc
ggcttcgtgggccgcgccaccctagccgaactcacccggcgcggctacgaggtcgtcgca
ggctcacggcagggcaagggcgtgggccggggcatcggcatcaagctggacgtgacgagt
gaaaaaagcgtgcggcaggcgcttcaggacgtgcagcccgccgccgtcattcatctggtg
ggcatcatcgccgagaaaggcaagcagaccttcgagcgtgtgcatatcgagggcacccgg
catgtgctggacgccctccgcgactatgacgctgcccggcaacaggcccacaagggcgac
gagatggagcgcccccaccccacccgctacctgcacatgagcgcgctcggcgccgatgtc
ctgagccccagcgcctactcgtggagcaagggcgaggccgaggggctggtgcgcctcagc
gggctgccctggaccatcttccgccccagcctgattttcggcgtgggcgacgactttttc
gggcgggtgctgaaaaatctggtgtcggcggccccggtggttccccaaatcggagacggg
caattccctttccgccccatcagcgtggaggacgtggcgctggcctttgcggaggcgctg
gtcaagccggaaacggttggacagatttatgcgctcaccggcccgcaggagttcaccttc
aaggagttgctggcgctggagcagcaggcgctcggtcagcaaaaaaaggtggtgccggtg
ccccagaagctgatggacctcgccgtcccggtcatcagccgcctgcccgccgcgcccatc
acccgcgaccagtacgcgatgctcaaggccggcaacaccgcaccgaacgacgccgcccgc
gccgccttcaacctgccgctgcaccgcttgcaggaccggctgccgtacatcgtggaccgg
aaataa

DBGET integrated database retrieval system