KEGG   Deinococcus radiodurans: DR_1980Help
Entry
DR_1980           CDS       T00025                                 

Definition
hypothetical protein
Orthology
K00329  
NADH dehydrogenase [EC:1.6.5.3]
K00356  
NADH dehydrogenase [EC:1.6.99.3]
Organism
dra  Deinococcus radiodurans
Pathway
Oxidative phosphorylation
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:dra00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1:2002633..2003598
Genome map
AA seq 321 aa AA seqDB search
MRGMAEQAEHPSRILVTGASGFVGRATLAELTRRGYEVVAGSRQGKGVGRGIGIKLDVTS
EKSVRQALQDVQPAAVIHLVGIIAEKGKQTFERVHIEGTRHVLDALRDYDAARQQAHKGD
EMERPHPTRYLHMSALGADVLSPSAYSWSKGEAEGLVRLSGLPWTIFRPSLIFGVGDDFF
GRVLKNLVSAAPVVPQIGDGQFPFRPISVEDVALAFAEALVKPETVGQIYALTGPQEFTF
KELLALEQQALGQQKKVVPVPQKLMDLAVPVISRLPAAPITRDQYAMLKAGNTAPNDAAR
AAFNLPLHRLQDRLPYIVDRK
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgcggggtatggctgagcaagcagaacatccctcccgcatcctcgtgaccggcgcgagc
ggcttcgtgggccgcgccaccctagccgaactcacccggcgcggctacgaggtcgtcgca
ggctcacggcagggcaagggcgtgggccggggcatcggcatcaagctggacgtgacgagt
gaaaaaagcgtgcggcaggcgcttcaggacgtgcagcccgccgccgtcattcatctggtg
ggcatcatcgccgagaaaggcaagcagaccttcgagcgtgtgcatatcgagggcacccgg
catgtgctggacgccctccgcgactatgacgctgcccggcaacaggcccacaagggcgac
gagatggagcgcccccaccccacccgctacctgcacatgagcgcgctcggcgccgatgtc
ctgagccccagcgcctactcgtggagcaagggcgaggccgaggggctggtgcgcctcagc
gggctgccctggaccatcttccgccccagcctgattttcggcgtgggcgacgactttttc
gggcgggtgctgaaaaatctggtgtcggcggccccggtggttccccaaatcggagacggg
caattccctttccgccccatcagcgtggaggacgtggcgctggcctttgcggaggcgctg
gtcaagccggaaacggttggacagatttatgcgctcaccggcccgcaggagttcaccttc
aaggagttgctggcgctggagcagcaggcgctcggtcagcaaaaaaaggtggtgccggtg
ccccagaagctgatggacctcgccgtcccggtcatcagccgcctgcccgccgcgcccatc
acccgcgaccagtacgcgatgctcaaggccggcaacaccgcaccgaacgacgccgcccgc
gccgccttcaacctgccgctgcaccgcttgcaggaccggctgccgtacatcgtggaccgg
aaataa

DBGET integrated database retrieval system