KEGG   Deinococcus radiodurans: DR_2594Help
Entry
DR_2594           CDS       T00025                                 

Definition
magnesium protoporphyrin chelatase
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
dra  Deinococcus radiodurans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:dra00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1:2600254..2601717
Genome map
AA seq 487 aa AA seqDB search
MTAQTTAQPKARTLGELLQTPEYAGRKPFDGQRRLVQDEVRDNLTRKLRSGEELFPGVVG
YDDTVIPQLVNALLARQNFILLGLRGQAKSRILRAITELLDPEVPVIDGVDMPDDPLNPI
GAEGQHLLEAHGMELPIRWLPRADRYVEKLATPDVTVADLIGDVDPIKAARLGTSLGDTR
SMHFGLLPRANRGIFAVNELADLSPKVQVALFNILQEGDVQIKGYPIRLELDVMLVFSAN
PEDYTARGKIVTPLKDRIGSEIRTHYPTDVQLGMDITAQEAVKEEGVVVPPFIAELIEDI
AFQAREDGRIDKLSGVSQRLPISLMELACANAERRSLVSGDAPVVRVTDVYAGLPAITGK
MELEYEGELKGADNVAKDLIRKAAGAAYARSYGSADTRELEKWFDQGNVFRFPQGGDASA
ALKATGEVPGLSDFAAQVAGSSDDAVRVSAAEFILEGLYGRKKLSRAEELYAAPEPELKR
ERGGRWN
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcccagaccacagcgcagcccaaagccaggaccctcggcgagctgctgcaaacg
ccggaatacgccgggcgcaagcccttcgacggccagcgccgactggtgcaggacgaggtg
cgggacaatctgacccgcaaactccgcagcggtgaggagctgtttcccggcgtggtcggc
tatgacgacaccgtgattccccagctcgtcaacgcgctgctcgcccgccagaacttcatt
ctgctcgggctgcgcggtcaggccaagagccgcatcctgcgcgccattaccgagctgctc
gaccccgaagtgccggtgatcgacggcgtggacatgcccgacgaccccctcaaccccatc
ggcgccgagggccagcacctgctcgaagcgcacggaatggaactgccgattcgctggctg
ccgcgtgccgaccgctacgtggaaaaactggcgacccccgacgtgacggtggccgacctc
atcggcgacgtggaccccatcaaggccgcccgcctcggcacctcgctcggcgacacccgc
tccatgcacttcggcctgctgccccgcgccaaccgggggatttttgcggtgaacgaactc
gccgacctctcgcccaaggtgcaggtcgcgctgttcaatatccttcaggaaggcgacgtg
cagatcaagggttaccccatccgcctcgaactcgacgtgatgctggtcttttcggccaac
cccgaggactacaccgctcgcggcaagatcgtcacgccgctcaaggaccgcatcggctcg
gaaatccgcacccactaccccaccgacgtgcagctcggcatggacatcaccgcgcaggaa
gccgtgaaggaagagggcgtggtcgtgccgcccttcatcgctgaactgattgaagacatc
gccttccaggcccgcgaagatggccgcatcgacaagctctcgggcgtgtcgcagcgcctg
ccgatttcgctgatggaactcgcctgcgccaacgccgagcgccgctcgctggtctccggt
gacgccccggtggtgcgcgtgactgacgtgtacgcgggcctcccggcgattaccggcaag
atggagctggaatacgaaggcgaactcaagggcgccgacaacgtcgccaaggacctcatt
cgcaaggcggcgggcgccgcgtatgcccgcagctacggcagcgccgacacccgcgagctg
gaaaagtggtttgaccagggcaacgtcttccgcttcccgcagggcggtgacgcgtcggca
gccctcaaggccacgggcgaagtccccggcctgtccgacttcgccgcgcaggtggccggg
agcagcgacgatgccgtgcgcgtgtccgccgccgagttcattctggagggactgtatggc
cggaaaaagctctcccgcgccgaggaactctacgccgcccccgaacccgagctgaagcgc
gaacgcggcggacgctggaattga

DBGET integrated database retrieval system