KEGG   Deinococcus radiodurans: DR_2594Help
Entry
DR_2594           CDS       T00025                                 

Definition
magnesium protoporphyrin chelatase
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
dra  Deinococcus radiodurans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dra00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    DR_2594
Enzymes [BR:dra01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     DR_2594
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2600254..2601717
Genome map
AA seq 487 aa AA seqDB search
MTAQTTAQPKARTLGELLQTPEYAGRKPFDGQRRLVQDEVRDNLTRKLRSGEELFPGVVG
YDDTVIPQLVNALLARQNFILLGLRGQAKSRILRAITELLDPEVPVIDGVDMPDDPLNPI
GAEGQHLLEAHGMELPIRWLPRADRYVEKLATPDVTVADLIGDVDPIKAARLGTSLGDTR
SMHFGLLPRANRGIFAVNELADLSPKVQVALFNILQEGDVQIKGYPIRLELDVMLVFSAN
PEDYTARGKIVTPLKDRIGSEIRTHYPTDVQLGMDITAQEAVKEEGVVVPPFIAELIEDI
AFQAREDGRIDKLSGVSQRLPISLMELACANAERRSLVSGDAPVVRVTDVYAGLPAITGK
MELEYEGELKGADNVAKDLIRKAAGAAYARSYGSADTRELEKWFDQGNVFRFPQGGDASA
ALKATGEVPGLSDFAAQVAGSSDDAVRVSAAEFILEGLYGRKKLSRAEELYAAPEPELKR
ERGGRWN
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcccagaccacagcgcagcccaaagccaggaccctcggcgagctgctgcaaacg
ccggaatacgccgggcgcaagcccttcgacggccagcgccgactggtgcaggacgaggtg
cgggacaatctgacccgcaaactccgcagcggtgaggagctgtttcccggcgtggtcggc
tatgacgacaccgtgattccccagctcgtcaacgcgctgctcgcccgccagaacttcatt
ctgctcgggctgcgcggtcaggccaagagccgcatcctgcgcgccattaccgagctgctc
gaccccgaagtgccggtgatcgacggcgtggacatgcccgacgaccccctcaaccccatc
ggcgccgagggccagcacctgctcgaagcgcacggaatggaactgccgattcgctggctg
ccgcgtgccgaccgctacgtggaaaaactggcgacccccgacgtgacggtggccgacctc
atcggcgacgtggaccccatcaaggccgcccgcctcggcacctcgctcggcgacacccgc
tccatgcacttcggcctgctgccccgcgccaaccgggggatttttgcggtgaacgaactc
gccgacctctcgcccaaggtgcaggtcgcgctgttcaatatccttcaggaaggcgacgtg
cagatcaagggttaccccatccgcctcgaactcgacgtgatgctggtcttttcggccaac
cccgaggactacaccgctcgcggcaagatcgtcacgccgctcaaggaccgcatcggctcg
gaaatccgcacccactaccccaccgacgtgcagctcggcatggacatcaccgcgcaggaa
gccgtgaaggaagagggcgtggtcgtgccgcccttcatcgctgaactgattgaagacatc
gccttccaggcccgcgaagatggccgcatcgacaagctctcgggcgtgtcgcagcgcctg
ccgatttcgctgatggaactcgcctgcgccaacgccgagcgccgctcgctggtctccggt
gacgccccggtggtgcgcgtgactgacgtgtacgcgggcctcccggcgattaccggcaag
atggagctggaatacgaaggcgaactcaagggcgccgacaacgtcgccaaggacctcatt
cgcaaggcggcgggcgccgcgtatgcccgcagctacggcagcgccgacacccgcgagctg
gaaaagtggtttgaccagggcaacgtcttccgcttcccgcagggcggtgacgcgtcggca
gccctcaaggccacgggcgaagtccccggcctgtccgacttcgccgcgcaggtggccggg
agcagcgacgatgccgtgcgcgtgtccgccgccgagttcattctggagggactgtatggc
cggaaaaagctctcccgcgccgaggaactctacgccgcccccgaacccgagctgaagcgc
gaacgcggcggacgctggaattga

DBGET integrated database retrieval system