KEGG   Deinococcus radiodurans: DR_2632Help
Entry
DR_2632           CDS       T00025                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
dra  Deinococcus radiodurans
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dra00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    DR_2632
   00670 One carbon pool by folate
    DR_2632
Enzymes [BR:dra01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     DR_2632
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1:2642723..2643265
Genome map
AA seq 180 aa AA seqDB search
MSSQAALCGTVPSRQDIVAIAAQTENRVIGRDGGMPWHLPADFAHFRALSVGKPNIMGRK
VFDTLRRKPLPERVNIVLTRNENLKFDGCLIAHSPEEALQLAGDAPEIAIIGGEEIYRLY
WDRLTRLEMTLIHAELDGDTFFPEIGPEWELAQETFRPADEKNRYDLTFQTWRRRGSGQP
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
ttgagttctcaagcggcattgtgtggaaccgtgccgtcccgtcaagacattgttgccatc
gctgcccagactgaaaaccgcgtcatcgggcgtgatggcgggatgccctggcatttgccg
gctgactttgcacattttcgggcactcagcgttggcaagccaaatattatggggcgcaag
gtctttgacacactgagacgtaagcctttgcccgaacgggtcaacattgtgctcacccgc
aacgagaacttgaaattcgacggctgtctcatcgcccattcgcccgaagaagccctccaa
ctcgccggagacgctcccgaaatcgccatcatcggcggcgaggagatttaccggctctac
tgggaccggctgacccggctggagatgacgctgattcacgcggaactggacggcgatacc
ttcttccccgaaatcgggcctgagtgggaactggcgcaggaaaccttccgacccgccgac
gagaagaatcgctacgacctgactttccagacgtggcgacggcggggctctgggcaacca
tga

DBGET integrated database retrieval system