KEGG   Deinococcus radiodurans: DR_A0011Help
Entry
DR_A0011          CDS       T00025                                 

Definition
(RefSeq) uroporphyrin-III C-methyltransferase/uroporphyrinogen-III synthase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
dra  Deinococcus radiodurans
Pathway
dra00860  Porphyrin and chlorophyll metabolism
dra01100  Metabolic pathways
dra01110  Biosynthesis of secondary metabolites
dra01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dra00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    DR_A0011
Enzymes [BR:dra01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     DR_A0011
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     DR_A0011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase HEM4
Motif
Other DBs
NCBI-GeneID: 1798160
NCBI-ProteinID: NP_285335
UniProt: Q9RZD8
Position
2:complement(10477..12030)
Genome map
AA seq 517 aa AA seqDB search
MKNWVLIRRPPHKEKSPMSEVSLPAALPAPFVSLVGAGPGDPGLLTLRAREVLAQADVVL
TDALVSPALLAHCPQARVVEVGKRGFLPSAKQEDINDLIVREALAGGGQRVVRLKGGDPF
VFGRGGEEALACRAAGVPCEIVPGVSSAVAAAAYAGIPVTHRGLSRSFAVLTGTDRHGPA
AYAEIAGVDTLVFLMGVRHLPQITADLIAAGRDPQTPAAAVQWASTPQQRTVRATLGTLA
QRAAEAGLGAPAVTVVGAVAALHDDLDWFCPAPLPLQGAQVAVTRTREQTGSELAALLSG
RGAQVSEIPLLRFVPASSPRTLVGALNGFDGWVLLTSEQAVRALARTLLAAGRDLRVLAR
ARIAAVGSGTAWTLREYGLAPDFVPTRSGSRHLGAELPAAPGEVALHVGSQDTDAVLEMA
LSARGIEYVAAEAYRSELSELTPAQREQLQEAQVVTLASAVGARALAQVAGTSFTAAVIG
PQTELAAREAGFTRLILAEQPTLASLSDAVQRACRAG
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaattgggttctcatcaggagacccccgcacaaggagaagtcacccatgtctgaa
gtttcgttgcctgccgcgctgcccgctcctttcgtttcgctggtgggggccggccccggt
gaccccggcctgctcacgctgcgtgcccgcgaggtgctggcgcaggcggacgtggtgctg
accgacgcgctcgtcagcccggcgctgctggcgcactgcccccaggcgcgggtggtagaa
gtgggcaaacgcgggttcctgccctcagccaagcaggaagacatcaacgacctgatcgtg
cgcgaggcgctcgcgggcggcggacagcgggtggtgcggctcaaggggggcgaccccttt
gtcttcgggcgcgggggcgaggaggcgctggcgtgccgggccgccggggtgccgtgcgaa
atcgtgccaggggtgagcagcgccgtggcagcggcagcctacgcggggattccggtcacg
caccgggggctgagccgcagcttcgccgtgctgaccggcaccgaccggcacgggcccgcc
gcctatgccgagatcgccggggtggacacgctggtgtttctgatgggcgtgcggcacctg
ccgcagattacggcggacctgatcgcggcgggccgtgacccgcagacccccgccgccgct
gtgcagtgggcgagcacgccgcagcagcgcacggtgcgcgcgaccctcggcacgctggcg
caacgggcagccgaggccggcttgggcgcgcccgccgtgaccgtggtgggtgcggtggcc
gcgctgcacgacgacctcgactggttttgcccggcgccgctgccgctgcaaggcgcgcag
gtggccgttacccgcacccgcgaacagacgggcagcgaactcgcggccctgctcagcgga
cgcggcgcccaggtcagcgagattccgctgctccgtttcgtgccggccagcagcccgcgc
acactggtgggcgccctgaacggcttcgatggctgggtgctcctgacaagcgaacaggca
gtgcgggcactcgcgcggacactgctcgccgctgggcgtgacttgcgggtgctggcccgc
gcccgcatcgctgccgtgggcagcggcaccgcctggactctacgcgagtacggcctcgct
cccgatttcgtccccacgcgctccggctcgcgccacctcggggccgaactgcccgccgcg
cccggtgaagttgcgctgcacgtcggctcgcaggacaccgacgcggtgctcgaaatggcg
ttgagcgcgcggggcatcgaatacgtggccgccgaagcctaccgcagcgaactcagcgag
ctgaccccggcccagcgcgagcagttgcaggaggcgcaagtggtgactctggcctcggcg
gtgggagcgcgcgcactcgcgcaggtggcgggcaccagttttaccgccgccgtcattggc
ccgcagaccgaactcgccgcccgcgaagccggatttacccgcctgattctggccgagcag
cccaccctggcgagtctgagcgacgcggtgcagcgggcgtgccgggcggggtaa

DBGET integrated database retrieval system