KEGG   Deinococcus radiodurans: DR_A0043Help
Entry
DR_A0043          CDS       T00025                                 

Definition
lipopolysaccharide biosynthesis protein
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
dra  Deinococcus radiodurans
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dra00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    DR_A0043
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    DR_A0043
Enzymes [BR:dra01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     DR_A0043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2:47626..48174
Genome map
AA seq 182 aa AA seqDB search
MADHKIKLAPEYAEALGFENYSAQPQIEGVWFHSLKKNRSENGAFMEYVRLDENGVQNLP
GQLVPRQISVSWAAPKRINAFHIHVKEEQNEIWCVLQGQLTIWLVDCRAGSPTVGVKRKL
VFSGEQPMMVHIPSGVAHGYQAGENGATLLYTMDAQFNIEDPNEGRLPWNFFGDDLWAED
MG
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggctgaccacaagatcaaactggctcccgaatacgccgaggcgcttggctttgagaac
tactcggcccagccgcagattgagggtgtatggtttcactccctcaagaagaaccgcagc
gagaacggcgcttttatggagtatgtccgtctcgacgaaaatggtgtacagaacctgccg
ggtcagctcgttccccgccagatcagcgtgtcctgggcggcgccgaagcgcatcaacgct
tttcacattcacgtcaaggaagagcagaacgagatctggtgcgtgctgcagggccagctg
accatctggttggtggactgccgggcagggagcccgacggtaggtgtcaaacgcaaactg
gtctttagcggtgagcagccgatgatggtgcatattcctagtggcgtggcccacgggtat
caggctggcgagaatggcgcgactctgctctacaccatggacgcccagttcaacattgaa
gaccccaacgagggccgcctgccctggaacttcttcggagatgacctctgggccgaggac
atgggttga

DBGET integrated database retrieval system