KEGG   Deinococcus radiodurans: DR_A0055Help
Entry
DR_A0055          CDS       T00025                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
dra  Deinococcus radiodurans
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:dra00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    DR_A0055
Enzymes [BR:dra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     DR_A0055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2:59503..60405
Genome map
AA seq 300 aa AA seqDB search
MSGSEGTDLPRVLVVGSANLDFVTRLSHLPAPGETVLGESYTTAPGGKGANQAVACARAG
GAVAFCGALGTDPFAEPLLASLRESGVQDWTVRASTPTGAAFISVSEAGENCIAVASGAN
GTLRPEQLPPLTGVGWLVLQLEIPLETVQAAAQAAREAGAQVVLNAAPARTLPPELLRLV
DVLIVNEGELRTLIGATDLRAGVRQAQASGPRTVVVTLGERGCLALSGDDWTELPALPVP
VRDTTGAGDTFVGVLVAALSRGEPFAAALRWAVAGSALACTREGAQPAMPGREEIQANLG
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgtccggctctgagggcactgacctgccgcgcgtgctggtcgtcggcagcgccaacctc
gacttcgtgaccaggctgtcgcacctgcccgcgcccggtgaaaccgtactgggcgagtcg
tacaccaccgcgcccggcggcaagggggcgaatcaggcggtggcctgcgcccgcgccggg
ggagcagtcgccttctgcggggcgctgggcacggaccccttcgccgaaccgctgctcgcc
tcgctgcgcgaaagtggggtgcaggactggactgtgcgcgcatctaccccgacaggcgcg
gcctttatcagcgtgtcggaggcgggcgaaaactgcatcgcggtggcgtccggcgcgaat
ggcacgctgcgccccgagcaactgcccccgctgaccggggtgggttggctggtgctgcaa
ctcgaaatcccgctggagaccgtgcaggccgccgctcaggcggcgcgggaggcgggcgcc
caggtggtgctcaacgccgcgcccgcccggacgctgccccccgaactgctgcggctggtg
gacgtgctcatcgtcaacgagggtgaattgcggacgctgatcggggccaccgacctgcgc
gcaggcgtgcggcaggcccaggcgagtggcccgcgcacggtggtcgtcaccctgggagaa
cgcggctgtctagcactgagcggcgacgactggaccgagctgccggccctgcccgtgccg
gtgcgcgacacgaccggcgcgggtgacactttcgtgggcgtgctcgtcgcagcgctgagc
cgaggagagccgttcgccgctgcgctgcgctgggcggtggcgggcagtgccctcgcctgc
acccgtgagggcgcccagccggcgatgccagggcgagaggagattcaagcaaatctgggg
taa

DBGET integrated database retrieval system