KEGG   Deinococcus radiodurans: DR_A0149Help
Entry
DR_A0149          CDS       T00025                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
dra  Deinococcus radiodurans
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dra00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    DR_A0149
Enzymes [BR:dra01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     DR_A0149
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
2:complement(149511..150425)
Genome map
AA seq 304 aa AA seqDB search
MSGPAHLPYGGIPTFARAPLVQPDGDWQADVAALGVPFDIALGFRPGARFAPRALREASL
RSVPPFTGLDGKTRLQGVTFADAGDVILPSLEPQLAHDRITEAARQVRGRCRVPVFLGGD
HSVSYPLLRAFADVPDLHVVQLDAHLDFTDTRNDTKWSNSSPFRRACEALPNLVHITTVG
LRGLRFDPEAVAAARARGHTIIPMDDVTADLAGVLAQLPRGQNVYFSVDVDGFDPAVIPG
TSSPEPDGLTYAQGMKILAAAAANNTVVGLDLVELAPNLDPTGRSELLMARLVMETLCEV
FDHV
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggccggcccacctgccctacggcggcattccgaccttcgcccgcgccccgctg
gtgcaaccggacggcgactggcaggcggacgtggccgccctcggcgtccccttcgacatc
gccctcggctttcgccccggcgcccgtttcgccccgcgtgcgctgcgggaggcgagtctg
cgcagcgtgccccccttcaccggtctggacggcaaaacccgcttgcagggcgtgactttt
gccgatgcgggcgacgtgattttgccctcgcttgaaccccaactcgcccacgaccgcatc
accgaggcggcgcggcaggtgcgggggcgctgccgggtgccggtgtttctcggcggcgac
cactcggtgagttatccgctgctgcgcgcttttgccgacgtgcccgaccttcacgtcgtg
cagctcgacgcgcacctcgacttcaccgacacccgcaacgacacgaaatggagcaactcc
agcccctttcgccgcgcctgcgaagccctgcccaacctcgtccacatcaccaccgtcggc
ctgcgcgggctgcgcttcgacccggaggcggtggcggcggcgcgggcgcggggccacaca
atcattccgatggacgacgtgaccgccgacctcgcgggcgtgctggcccagctgccacgc
ggccagaacgtgtatttctcggtggacgtggacggcttcgaccccgccgtgattcccggc
acgtccagccccgagcccgacggcctgacctacgcgcagggcatgaagattctggcggca
gcggcggcgaataatacggtggtgggcctcgatttggtcgaactcgcccccaacctcgac
ccgacgggccgcagcgaactgctaatggcgcggctggtgatggagacgctgtgcgaggtg
ttcgaccatgtctga

DBGET integrated database retrieval system