KEGG   Deinococcus radiodurans: DR_A0277Help
Entry
DR_A0277          CDS       T00025                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
dra  Deinococcus radiodurans
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:dra00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DR_A0277
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    DR_A0277
   00630 Glyoxylate and dicarboxylate metabolism
    DR_A0277
Enzymes [BR:dra01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     DR_A0277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(299112..300677)
Genome map
AA seq 521 aa AA seqDB search
MTDLNLPAGMTINAPIKPEYAEILTPEALAFVAELHRRFEPRRRELMQKREERQQRLDAG
ELPDFLPETAEIRAGDWKISPLPDALKDRRVEITGPVDRKMIINALNSGAKMFMADFEDA
SSPTWDNCVQGQINLRDAVRGTISLEQNGKSYKLNDTTATLLVRPRGWHLPEKHVQVDGE
TLYGAFFDFGLFFFHNAKEQLARGKGPYFYLPKMESHLEARLWNDVFNYAEDTIQIPRGS
IRATVLIETIVAAFEMDEILYELREHSAGLNCGRWDYIFSYIKKLRNHSDRVLPDRAKVT
MAVPMMQNYSKLAIQTCHKRGAPAIGGMSAFIPVKGDEEKNAAAFEQVRVDKEREATNGH
DGTWVAHPGMVQLATEVFDRIMPQPNQIGSDKQKDFSLTATDLLQAPEGSVTEAGVRTNI
NVGIQYLAAWLRGSGAVPIHNLMEDAATAEISRAQLWQWLKQGVTLEDGRTLDQGLFDQL
YTEETDKLGAEFADASALFKQTATGDTLVDFLTLPGYQQLA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacctgaacctgcccgccggaatgaccatcaacgcgccgatcaagcccgagtat
gccgagattctgacgcccgaggcgctggcattcgtcgccgagctgcaccgccgcttcgag
ccgcgccgccgcgagctgatgcaaaagcgcgaggagcgccagcaacgccttgacgcgggc
gaactgcctgactttctccccgaaaccgccgagattcgtgcgggcgactggaaaatcagc
ccgctgcccgacgctctgaaagaccgccgcgtcgagattaccggcccggtggaccgcaag
atgatcatcaacgcgctcaactccggcgcaaagatgttcatggccgacttcgaggacgcc
agcagccccacctgggacaactgcgtgcagggccagatcaacctgcgcgacgcggtgcgc
ggcaccatcagcctggaacagaacggcaagagctacaagctcaatgacacgacggccacc
ctgctggtgcgtccgcgcggctggcacctgccggaaaagcatgtgcaagtggacggcgag
acgctttacggcgccttcttcgacttcggactgttcttcttccacaacgccaaggagcag
cttgcccgtggcaagggcccgtacttctacctgcccaagatggagtcgcacctcgaagcg
cggctgtggaacgacgtgttcaactacgccgaggacaccattcagattccgcgcggcagc
attcgcgccaccgtgctcatcgaaaccatcgtggcggcgttcgagatggacgagattctc
tacgaactgcgcgagcactcggcgggcctgaactgcgggcgctgggactacatcttttcc
tacatcaagaagctgcgcaaccactccgaccgcgtgctgcccgaccgcgccaaggtcacc
atggccgtgcccatgatgcagaactactccaagctcgccatccagacctgccacaagcgt
ggcgccccggccatcggcggcatgagcgcctttatcccggtcaagggcgacgaggaaaag
aacgcggcggccttcgagcaggtgcgcgtggacaaggaacgcgaagccaccaacggccac
gacggcacctgggtcgcgcaccccggcatggtgcagctcgccaccgaggtcttcgaccgc
atcatgccgcagcccaaccagattggcagcgacaagcaaaaggacttcagtctgaccgcc
actgatctgcttcaggcgcccgaaggcagcgtgaccgaagccggcgtgcggaccaacatc
aatgtgggcattcagtacctcgcggcgtggctgcgcggcagtggcgcggtgccgattcac
aacctgatggaagacgccgccaccgctgaaatcagccgcgcgcagctgtggcagtggctc
aagcaaggcgtgacgctcgaagacgggcgcaccctcgaccagggcctcttcgaccagctc
tacaccgaggaaaccgacaagctgggcgccgagtttgccgacgcctcggccctgttcaag
cagaccgccacgggcgacaccctggtggacttcctgacgctgcccggctaccagcagctg
gcctga

DBGET integrated database retrieval system