KEGG   Deinococcus radiodurans: DR_B0073Help
Entry
DR_B0073          CDS       T00025                                 

Definition
PTS system, fructose-specific IIBC component
Orthology
K02769  
PTS system, fructose-specific IIB component [EC:2.7.1.69]
K02770  
PTS system, fructose-specific IIC component
Organism
dra  Deinococcus radiodurans
Pathway
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:dra00051]
Environmental Information Processing; Membrane transport; Phosphotransferase system (PTS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
MP1:complement(89214..91010)
Genome map
AA seq 598 aa AA seqDB search
MAKLVAVTACPTGIAHTFMAAEALRRAALAAGHDIRVETQGSVGTADALTPSEIAAADAV
ILATDVRVDEARFAGKPVVQTSTQDAIRNAAGLVAQATAALGAAAPAAAPVSDGKKYIVG
ITSCPTGIAHTFMAAEGLEGGAKSLGYDVKIETQGSVGAGNALSDDDVRRADVVVIAADT
NVDLSRFAGKRVYQTGTKPAIKDGAAVVRTALAEAPVYGSGSAASSGDYVADAAAAKAAK
NAGVPSFYKHLMTGVSHMLPFVVAGGLLIALGFAFGSFQFGDQGIFIYEDKYAGTIGNLL
FNIGANGAFKLFVPVLAGYIAFSIADRPGLAPGMVGGLIAANTGSGFLGGMVAGFIAGYF
VRWLNRALKLPRTLEGLKPTLLLPLLGTLVVGLLMLTVVGKPVAAALTAVTNWLQGLGQG
SAGLLGALLGGMMAFDMGGPINKAAYTFSTGLLTNKVYGPIAATMAAGMTPPLALFFATQ
LFKNRFTKDEQEAGKAAGVLGISFITEGAIPFAARDPLRVIPALMAGSAVAGFISMATGC
LLRAPHGGIFVLFIPNAVTNLPMYIVAIVAGTAVSTLLLGLLKKPLAVTPVPSGEGTL
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaacttgtcgccgtcaccgcctgtcccaccggcatcgcccacacctttatggcc
gccgaggccctgcgccgcgccgcgctcgccgccgggcacgacatccgggtggaaacccag
ggcagcgtgggcaccgccgacgccctgacgcccagtgaaattgccgccgccgacgccgtg
attctggcgaccgacgtgcgggtggacgaggcgcgctttgccggaaaacccgtcgtgcag
accagcacccaggacgccattcggaatgcggcgggcctagtcgcgcaggcgacggcggcg
ctgggcgcggcggcccccgcagccgcccccgtcagcgacggcaaaaagtacatcgtcggc
atcacgtcgtgcccgaccggcatcgcccacaccttcatggccgccgaagggctcgaaggc
ggcgccaagtcgctcggttacgacgtgaaaatcgagacgcagggcagcgtgggcgccggc
aacgcgctgagcgacgacgatgttcgccgcgccgacgtggtggtcatcgccgccgacacc
aacgtggacctgagccgctttgccggcaaacgcgtgtaccagaccggcaccaagcccgcc
atcaaggacggcgcggcggtcgtccgcacggcgctcgccgaggcgccggtgtacggaagc
gggtcggcggcgagttcgggcgactacgtggccgacgcggcggcggcgaaagcggccaag
aacgcgggcgtgccgagcttctacaagcacctgatgaccggcgtgagccacatgctgccc
ttcgtggtggcgggcgggctgctcatcgcgctgggcttcgccttcgggtcgtttcagttt
ggggaccagggcattttcatctacgaggacaagtacgccgggaccatcggcaacctgctg
ttcaacatcggggcgaacggggcgttcaagctgttcgtgccggtgctggccggctacatc
gccttttcgattgccgaccgaccggggctggcgccgggcatggtgggcggcctgatcgcc
gcgaacaccggcagcggctttctgggcgggatggtcgcgggctttatcgccgggtacttc
gtgcgctggctcaaccgcgccctgaagttgccgcgcacgctcgaaggcctcaagcccacg
ctgctgctgccgctgctcggcaccctggtggtcgggctgctgatgctgacggtggtgggc
aagccggtggccgccgccctgaccgccgtgacgaactggctgcaaggcctgggccagggg
tcggcggggctgctcggcgccctgctcggcgggatgatggccttcgacatgggtggcccc
atcaacaaggcggcctacaccttcagcaccggcctgctgacgaacaaggtctacggcccc
atcgccgccacgatggctgcgggcatgacgcccccgctggcgctgtttttcgccacacaa
ctgttcaagaaccgctttaccaaagatgagcaggaagcgggcaaggcggcaggcgtgctg
ggcatttcctttatcacggaaggcgccattcccttcgccgcccgtgaccccctgcgcgtg
attccggcgctgatggcggggtcggcggtggcgggctttatcagcatggcgaccgggtgc
ctgctgcgggcgccgcacggcgggattttcgtgctgtttattcccaacgcggtgaccaac
ctgccgatgtacatcgtggccatcgtggcgggcacggctgtgagcacgctgctgctcggg
ctgctgaaaaaaccgctggccgtcacgcccgtgccgagcggtgaaggaacactctga

DBGET integrated database retrieval system