KEGG   Danio rerio (zebrafish): 100000750Help
Entry
100000750         CDS       T01004                                 

Gene name
g6pcb
Definition
glucose-6-phosphatase b, catalytic subunit
Orthology
K01084  
glucose-6-phosphatase [EC:3.1.3.9]
Organism
dre  Danio rerio (zebrafish)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
FoxO signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100000750 (g6pcb)
   00052 Galactose metabolism
    100000750 (g6pcb)
   00500 Starch and sucrose metabolism
    100000750 (g6pcb)
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100000750 (g6pcb)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100000750 (g6pcb)
   04920 Adipocytokine signaling pathway
    100000750 (g6pcb)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     100000750 (g6pcb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
3
AA seq 363 aa AA seqDB search
MLLYSRSAAIMEVLYGYGISSTLYLQKHFGHAQSWFTFVSTIADLRTTFLFFFPIWFHLQ
SAVGVKLVWVAVVGDWLNLVLKWLMFGERPYWWVRETVYYGNLTVPQIKQFPMTCETGPG
SPSGHAMGAAGVYYAMVTSLLLNFKECDPLKRWCLQALLWAVFWSVQVCVSLSRVFIAAH
FPHQVIAGVFSGIAVAKAFNRVSWIYSASLKGYMHSILCLVFVALGLYAVLDAASIDPYW
SLMKAQKWCIQSEWVHLDTTPFAGLLRNTGALFGLGLSLHLPTHGDLQKNKNCGNSAFYR
LTCTAATLPLLSLLDSFRPPTSTHALFYTLSFCKSATVPLTTISFVPYCISTLANAYRRM
KAH
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgttgctctatagcagatcagctgcaataatggaagtattgtatggttatgggataagt
agcacattatacctgcagaagcattttgggcacgctcaaagctggtttacctttgtgtca
acaatagcagacctgcggacaacatttttattttttttccccatttggttccacctacaa
tcagcagtgggagtcaagctagtctgggttgctgttgtaggagactggctcaacttagtt
cttaagtggctcatgtttggcgagagaccttactggtgggtgagagaaactgtttattat
ggcaacttgactgtaccacaaattaaacagttcccaatgacctgtgagaccggccctgga
agcccctcgggacatgcaatgggcgctgcaggggtctactatgccatggttacgtcactg
ctgctgaatttcaaggagtgtgaccctctgaaaagatggtgcttgcaggctcttctttgg
gctgttttctggagtgtgcaggtgtgtgtcagtctttctcgagtcttcattgctgctcat
ttcccacatcaggtcattgctggagttttttcaggcattgcagtggccaaagctttcaac
agagtgtcctggatatactcagccagcttgaagggttacatgcacagcatcctctgtctg
gtgtttgttgcgctggggctttatgcggtgttggatgctgcttcaattgacccctactgg
agcctaatgaaggcacagaagtggtgtattcaatctgaatgggtccatctggacaccaca
cccttcgctggcctcctccgcaacacaggggccctgttcggcctgggactgagcctccat
ttgcctactcatggtgatttgcaaaaaaataagaactgtggaaacagcgccttttacaga
ctgacctgtacagctgcaaccctgcccctgctgagcctcttagactcgttcagaccaccc
accagcactcatgctctcttctacacgctgtctttctgtaagagtgccacagtgcctcta
actacaatcagttttgtaccttactgcataagcacactagcaaatgcgtaccgcaggatg
aaagcccattaa

DBGET integrated database retrieval system